HHSEARCH alignment of GI: 254780454 and SCOP domain: d1vpka2

Alignment
>d1vpka2 d.131.1.1 (A:121-243) DNA polymerase III, beta subunit {Thermotoga maritima [TaxId: 2336]}
Probab=99.32  E-value=7.5e-11  Score=82.08  Aligned_cols=115  Identities=17%  Similarity=0.177  Sum_probs=97.6

Q ss_pred             EEEEEHHHHHHHHHHHHHHHCCCCCCCHHCEEEEEEECCEEEEEEECCEEEEEEEEEEEECCCCEEEEEHHHHHHHHHCC
Q ss_conf             58985999999999875020378886101338999989979999967828999999777526807999499877887407
Q gi|254780454|r    2 KITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPASVDVCGSITVSAHLLYDIVRKL   81 (385)
Q Consensus         2 k~~i~~~~L~~~l~~v~~~i~~k~~~pil~~ilie~~~~~l~l~atd~~~~i~~~i~~~i~~~G~~~v~a~~l~~iik~L   81 (385)
                      +|+|+.+.|.++|+.+.-+++...+.|+|.|++++..++++.+.|||+-.-.....+.+..++++++||+|.+.++.|-+
T Consensus         6 ~f~i~~~~L~~~I~~v~fA~s~d~~r~~L~Gv~~~~~~~~l~~vATDg~RLa~~~~~~~~~~~~~~iiP~k~l~el~k~l   85 (123)
T d1vpka2           6 TFEVDTSLLEEMVEKVIFAAAKDEFMRNLNGVFWELHKNLLRLVASDGFRLALAEEQIENEEEASFLLSLKSMKEVQNVL   85 (123)
T ss_dssp             EEEEEHHHHHHHHHHHGGGSCCCTTCTTTSEEEEEEETTEEEEEEECSSEEEEEEEECCCCSCEEEEEEHHHHHHHHHHH
T ss_pred             EEEECHHHHHHHHHHEEEEECCCCCCCEEEEEEEEEECCCEEEEEEEEEEEEEEEHHCCCCCCCCEEEEECHHHHHHHHH
T ss_conf             99998999999984564995267862128768999846834899985125322301202477652798621356777652


Q ss_pred             CCCC--CEEEEEECCCCEEEEEEECCCEEEEECCCCCCCCC
Q ss_conf             7777--30477733675089998678202430366211432
Q gi|254780454|r   82 QDGA--QISFFKENELGTEVNISHGDSNFYLQSFPESEFPS  120 (385)
Q Consensus        82 ~~~~--~i~~~~~~~~~~~i~i~~~~~~~~l~~~~~~~fP~  120 (385)
                      ++..  .+.+..+   ++++.+++++..+.....+. .||.
T Consensus        86 ~~~~~~~v~i~~~---~~~i~~~~~~~~~~srlieG-~fPd  122 (123)
T d1vpka2          86 DNTTEPTITVRYD---GRRVSLSTNDVETVMRVVDA-EFPD  122 (123)
T ss_dssp             HTCCCSEEEEEEC---SSEEEEECSSEEEEEECCSS-CCCC
T ss_pred             CCCCCCEEEEEEC---CCEEEEEECCEEEEEEEECC-CCCC
T ss_conf             0035626999978---98999998999999976475-3879


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: DNA clamp
superfamily: DNA clamp
family: DNA polymerase III, beta subunit
domain: DNA polymerase III, beta subunit
species: Thermotoga maritima [TaxId: 2336]