BLAST/PSIBLAST alignment of GI: 254780454 and GI: 190889986 at iteration 1
>gi|190889986|ref|YP_001976528.1| DNA polymerase III, beta chain protein [Rhizobium etli CIAT 652] Length = 372
>gi|190695265|gb|ACE89350.1| DNA polymerase III, beta chain protein [Rhizobium etli CIAT 652] Length = 372
 Score =  361 bits (926), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 185/387 (47%), Positives = 260/387 (67%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+IT+ERS++L+ L H  R++ER+NTIP+  +VLL+A+   L++KA+  ++EIT A PAS
Sbjct: 1   MRITIERSNLLKSLNHVHRVVERRNTIPILSNVLLKADGQNLDMKATDLDLEITEATPAS 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DG+++      + G  + +  G S F LQ  PES+FP 
Sbjct: 61  VEQAGATTVPAHLLYDIVRKLSDGSEVLLATSTD-GGSMTVQSGRSKFSLQCLPESDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEE--DLKLCAVATDG 178
                + +SF+L ++ LK L++RT FA++TEE RYYLNGIFFH  E   +LKL AVATDG
Sbjct: 120 LTAGTFTHSFKLKATDLKMLIDRTQFAISTEETRYYLNGIFFHTIESKGELKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA A+VD  +    MP II+PRK VGE+ +++ + ++ V V +S+++I + I S+ ++
Sbjct: 180 HRLARADVDAPSGSEGMPGIIIPRKTVGELQKLVDNPEAIVTVEVSDAKIRMTIGSIVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDKE+RV+CT+  QAVDRVS +SS R +AVKL+LS  +L +T
Sbjct: 240 SKLIDGTFPDYQRVIPTGNDKEMRVDCTSFAQAVDRVSTISSERGRAVKLALSEGQLMLT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A E + V Y+   M+I FN KYLL+I   +S      +E +F L  + S   
Sbjct: 300 VNNPDSGSATEEVAVGYDTDAMEIGFNAKYLLDITAQLSG-----EEAIFLLADAGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           IR    D         +A YVLMPMR+
Sbjct: 355 IRDTAGD---------DALYVLMPMRV 372