BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780454|ref|YP_003064867.1| DNA polymerase III subunit
beta [Candidatus Liberibacter asiaticus str. psy62]
         (385 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780454|ref|YP_003064867.1| DNA polymerase III subunit beta [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040131|gb|ACT56927.1| DNA polymerase III subunit beta [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 385

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/385 (100%), Positives = 385/385 (100%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS
Sbjct: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS
Sbjct: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
           TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR
Sbjct: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR
Sbjct: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD
Sbjct: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR
Sbjct: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
           GKDKDSKNNKDNKVNAFYVLMPMRI
Sbjct: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385


>gi|315122098|ref|YP_004062587.1| DNA polymerase III subunit beta [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495500|gb|ADR52099.1| DNA polymerase III subunit beta [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 370

 Score =  544 bits (1401), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 281/386 (72%), Positives = 321/386 (83%), Gaps = 17/386 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+I VERS+ILE L H CRIIER+ TIPV+CHV LQ  DG L++KASGPEIEIT  IPA 
Sbjct: 1   MEIIVERSNILEPLNHVCRIIERRTTIPVACHVFLQTIDGSLKMKASGPEIEITEVIPAV 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           ++V GS TVSAHLLYDIVRK  +G++I F K +  GTEV +  GDS FYLQSF ESEFP+
Sbjct: 61  INVGGSATVSAHLLYDIVRKFPEGSEILFSKSDAQGTEVKVVSGDSQFYLQSFSESEFPN 120

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
            KEE+Y YSFEL SSVLK L+ERTHFAMATEEIRYYLNGIFFHINEED  LCAVATDGHR
Sbjct: 121 IKEEDYEYSFELESSVLKILIERTHFAMATEEIRYYLNGIFFHINEEDSTLCAVATDGHR 180

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSS-KDSSVKVSLSESRIHLNIESLSMSV 239
           LAVA+V++   IAKMPSIIVPRKAVGEI +I+S+ K  SVK+S+SESRIHLNI  LSMS+
Sbjct: 181 LAVAKVNV--PIAKMPSIIVPRKAVGEIQKIISTVKFLSVKISISESRIHLNIGRLSMSI 238

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           RLIDGEFP+YQNVIP +NDK LRVNC++LRQAVDRVS +SSVR QAVKLSLSS+KLCMTV
Sbjct: 239 RLIDGEFPHYQNVIPHNNDKVLRVNCSSLRQAVDRVSTISSVRNQAVKLSLSSEKLCMTV 298

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           DNP+MGKAIE ++V Y++CPMDICFNYKYLLEII NIS     DD+VVFRLDSS+SS  I
Sbjct: 299 DNPEMGKAIEYLDVNYHDCPMDICFNYKYLLEIIGNIS-----DDDVVFRLDSSSSSALI 353

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +G +     NKD    AFYVLMPMRI
Sbjct: 354 QGFE-----NKD----AFYVLMPMRI 370


>gi|209551896|ref|YP_002283813.1| DNA polymerase III subunit beta [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537652|gb|ACI57587.1| DNA polymerase III, beta subunit [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 372

 Score =  363 bits (932), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 187/387 (48%), Positives = 260/387 (67%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+IT+ERS++L+ L H  R++ER+NTIP+  +VLL+A+   L++KA+  ++EIT A PAS
Sbjct: 1   MRITIERSNLLKSLNHVHRVVERRNTIPILSNVLLKADGQNLDMKATDLDLEITEATPAS 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DG+++     ++ G  + +  G S F LQ  PES+FP 
Sbjct: 61  VEQSGATTVPAHLLYDIVRKLPDGSEVLLATSSD-GGSMTVQSGRSKFSLQCLPESDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEE--DLKLCAVATDG 178
                + +SF+L ++ LK L++RT FA++TEE RYYLNGIFFH  E   +LKL AVATDG
Sbjct: 120 LTAGTFTHSFKLKATDLKMLIDRTQFAISTEETRYYLNGIFFHTIESKGELKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA A+VD  +    MP II+PRK VGE+ +++ + + +V V +S+++I L I S+ M+
Sbjct: 180 HRLARADVDAPSGSEGMPGIIIPRKTVGELQKLVDNPEVTVTVEVSDAKIRLTIGSIVMT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDKE+RV+CT   QAVDRVS +SS R +AVKL+LS  +L +T
Sbjct: 240 SKLIDGTFPDYQRVIPTGNDKEMRVDCTTFAQAVDRVSTISSERGRAVKLALSEGQLMLT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A E + V Y+   M+I FN KYLL+I   +S      +E +F L  + S   
Sbjct: 300 VNNPDSGSATEEVAVGYDTDAMEIGFNAKYLLDITAQLSG-----EEAIFLLADAGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           IR    D         +A YVLMPMR+
Sbjct: 355 IRDTAGD---------DALYVLMPMRV 372


>gi|86355975|ref|YP_467867.1| DNA polymerase III subunit beta [Rhizobium etli CFN 42]
 gi|86280077|gb|ABC89140.1| DNA polymerase III, beta chain protein [Rhizobium etli CFN 42]
          Length = 372

 Score =  362 bits (929), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 186/387 (48%), Positives = 259/387 (66%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+IT+ERS++L+ L H  R++ER+NTIP+  +VLL+A+   L++KA+  ++EIT A PA+
Sbjct: 1   MRITIERSNLLKSLNHVHRVVERRNTIPILSNVLLKADGQNLDMKATDLDLEITEATPAN 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DGA++      E G  + +  G S F LQ  PES+FP 
Sbjct: 61  VEQAGATTVPAHLLYDIVRKLSDGAEVLLATSTE-GGSMTVQSGRSKFSLQCLPESDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEE--DLKLCAVATDG 178
                + +SF+L ++ LK L++RT FA++TEE RYYLNGIFFH  E   +LKL AVATDG
Sbjct: 120 LTAGTFTHSFKLKATDLKMLIDRTQFAISTEETRYYLNGIFFHTIESNGELKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA A+VD  +    MP II+PRK VGE+ +++ + ++ V V +S+++I + I S+ ++
Sbjct: 180 HRLARADVDAPSGSEGMPGIIIPRKTVGELQKLVDNPEAIVTVEVSDAKIRMTIGSIVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDKE+RV+CT   QAVDRVS +SS R +AVKL+LS  +L +T
Sbjct: 240 SKLIDGTFPDYQRVIPTGNDKEMRVDCTTFAQAVDRVSTISSERGRAVKLALSEGQLMLT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A E + V Y+   M+I FN KYLL+I   +S      +E +F L  + S   
Sbjct: 300 VNNPDSGSATEEVAVGYDTDSMEIGFNAKYLLDITAQLSG-----EEAIFLLADAGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           IR    D         +A YVLMPMR+
Sbjct: 355 IRDTAGD---------DALYVLMPMRV 372


>gi|116250102|ref|YP_765940.1| DNA polymerase III subunit beta [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115254750|emb|CAK05824.1| putative DNA polymerase III, beta chain [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 372

 Score =  362 bits (929), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 187/387 (48%), Positives = 260/387 (67%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+IT+ERS++L+ L H  R++ER+NTIP+  +VLL+A+   L++KA+  ++EIT A PAS
Sbjct: 1   MRITIERSNLLKSLNHVHRVVERRNTIPILSNVLLKADGQKLDMKATDLDLEITEATPAS 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DG+++     ++ G  + +  G S F LQ  PES+FP 
Sbjct: 61  VEQPGATTVPAHLLYDIVRKLSDGSEVLLATSSD-GGSMTVQSGRSKFSLQCLPESDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
                + +SF+L ++ LK L++RT FA++TEE RYYLNGIFFH  E +  LKL AVATDG
Sbjct: 120 LTAGTFTHSFKLKATDLKMLIDRTQFAISTEETRYYLNGIFFHTIESNGQLKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA A+VD  +    MP II+PRK VGE+ +++ + +  V V +S+++I L I S+ M+
Sbjct: 180 HRLARADVDAPSGSEGMPGIIIPRKTVGELQKLVDNPEVMVTVEVSDAKIRLTIGSIVMT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDKE+RV+CT+  QAVDRVS +SS R +AVKL+LS  +L +T
Sbjct: 240 SKLIDGTFPDYQRVIPTGNDKEMRVDCTSFAQAVDRVSTISSERGRAVKLALSEGQLMLT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A E + V Y+   M+I FN KYLL+I   +S      +E +F L  + S   
Sbjct: 300 VNNPDSGSATEEVAVGYDTDAMEIGFNAKYLLDITAQLSG-----EEAIFLLADAGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           IR    D         +A YVLMPMR+
Sbjct: 355 IRDTAGD---------DALYVLMPMRV 372


>gi|218509914|ref|ZP_03507792.1| DNA polymerase III subunit beta [Rhizobium etli Brasil 5]
          Length = 372

 Score =  361 bits (927), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 185/387 (47%), Positives = 259/387 (66%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+IT+ERS++L+ L H  R++ER+NTIP+  +VLL+A+   L++KA+  ++EIT A PAS
Sbjct: 1   MRITIERSNLLKSLNHVHRVVERRNTIPILSNVLLKADGQNLDMKATDLDLEITEATPAS 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DG+++      + G  + +  G S F LQ  PES+FP 
Sbjct: 61  VEQAGATTVPAHLLYDIVRKLSDGSEVLLATSTD-GGSMTVQSGRSKFSLQCLPESDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEE--DLKLCAVATDG 178
                + +SF+L ++ LK L++RT FA++TEE RYYLNGIFFH  E   +LKL AVATDG
Sbjct: 120 LTAGTFTHSFKLKATDLKMLIDRTQFAISTEETRYYLNGIFFHTIESKGELKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA A+VD  +    MP II+PRK VGE+ +++ + ++ V V +S+++I + I S+ ++
Sbjct: 180 HRLARADVDAPSGSEGMPGIIIPRKTVGELQKLVDNPEAIVTVEVSDAKIRMTIGSIVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDKE+RV+CT   QAVDRVS +SS R +AVKL+LS  +L +T
Sbjct: 240 SKLIDGTFPDYQRVIPTGNDKEMRVDCTTFAQAVDRVSTISSERGRAVKLALSEGQLMLT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A E + V Y+   M+I FN KYLL+I   +S      +E +F L  + S   
Sbjct: 300 VNNPDSGSATEEVAVGYDTDAMEIGFNAKYLLDITAQLSG-----EEAIFLLADAGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           IR    D         +A YVLMPMR+
Sbjct: 355 IRDTAGD---------DALYVLMPMRV 372


>gi|241207273|ref|YP_002978369.1| DNA polymerase III subunit beta [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240861163|gb|ACS58830.1| DNA polymerase III, beta subunit [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 372

 Score =  361 bits (927), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 187/387 (48%), Positives = 259/387 (66%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+IT+ERS++L+ L H  R++ER+NTIP+  +VLL+A+   L++KA+  ++EIT A PAS
Sbjct: 1   MRITIERSNLLKSLNHVHRVVERRNTIPILSNVLLKADGQKLDMKATDLDLEITEATPAS 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DG+++     +  G  + +  G S F LQ  PES+FP 
Sbjct: 61  VEQPGATTVPAHLLYDIVRKLSDGSEV-LLATSPDGGAMTVQSGRSKFSLQCLPESDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
                + +SF+L ++ LK L++RT FA++TEE RYYLNGIFFH  E +  LKL AVATDG
Sbjct: 120 LTAGTFTHSFKLKAADLKMLIDRTQFAISTEETRYYLNGIFFHTIESNGQLKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA A+VD  +    MP II+PRK VGE+ +++ + +  V V +S+++I L I S+ M+
Sbjct: 180 HRLARADVDAPSGSEGMPGIIIPRKTVGELQKLVDNPEVMVTVEVSDAKIRLTIGSIVMT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDKE+RV+CT+  QAVDRVS +SS R +AVKL+LS  +L +T
Sbjct: 240 SKLIDGTFPDYQRVIPTGNDKEMRVDCTSFAQAVDRVSTISSERGRAVKLALSEGQLMLT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A E + V Y+   M+I FN KYLL+I   +S      +E +F L  + S   
Sbjct: 300 VNNPDSGSATEEVAVGYDTDAMEIGFNAKYLLDITAQLSG-----EEAIFLLADAGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           IR    D         +A YVLMPMR+
Sbjct: 355 IRDTAGD---------DALYVLMPMRV 372


>gi|327192029|gb|EGE59010.1| DNA polymerase III subunit beta [Rhizobium etli CNPAF512]
          Length = 372

 Score =  361 bits (926), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 185/387 (47%), Positives = 259/387 (66%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+IT+ERS++L+ L H  R++ER+NTIP+  +VLL+A+   L++KA+  ++EIT A PAS
Sbjct: 1   MRITIERSNLLKSLNHVHRVVERRNTIPILSNVLLKADGQNLDMKATDLDLEITEATPAS 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DG+++      + G  + +  G S F LQ  PES+FP 
Sbjct: 61  VEQAGATTVPAHLLYDIVRKLSDGSEVLLATSTD-GGSMTVQSGRSKFSLQCLPESDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEE--DLKLCAVATDG 178
                + +SF+L ++ LK L++RT FA++TEE RYYLNGIFFH  E   +LKL AVATDG
Sbjct: 120 LTAGTFTHSFKLKATDLKMLIDRTQFAISTEETRYYLNGIFFHTIESNGELKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA A+VD  +    MP II+PRK VGE+ +++ + ++ V V +S+++I + I S+ ++
Sbjct: 180 HRLARADVDAPSGSEGMPGIIIPRKTVGELQKLVDNPEAIVTVEVSDAKIRMTIGSIVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDKE+RV+CT   QAVDRVS +SS R +AVKL+LS  +L +T
Sbjct: 240 SKLIDGTFPDYQRVIPTGNDKEMRVDCTTFAQAVDRVSTISSERGRAVKLALSEGQLMLT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A E + V Y+   M+I FN KYLL+I   +S      +E +F L  + S   
Sbjct: 300 VNNPDSGSATEEVAVGYDTDAMEIGFNAKYLLDITAQLSG-----EEAIFLLADAGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           IR    D         +A YVLMPMR+
Sbjct: 355 IRDTAGD---------DALYVLMPMRV 372


>gi|190889986|ref|YP_001976528.1| DNA polymerase III, beta chain protein [Rhizobium etli CIAT 652]
 gi|190695265|gb|ACE89350.1| DNA polymerase III, beta chain protein [Rhizobium etli CIAT 652]
          Length = 372

 Score =  361 bits (926), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 185/387 (47%), Positives = 260/387 (67%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+IT+ERS++L+ L H  R++ER+NTIP+  +VLL+A+   L++KA+  ++EIT A PAS
Sbjct: 1   MRITIERSNLLKSLNHVHRVVERRNTIPILSNVLLKADGQNLDMKATDLDLEITEATPAS 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DG+++      + G  + +  G S F LQ  PES+FP 
Sbjct: 61  VEQAGATTVPAHLLYDIVRKLSDGSEVLLATSTD-GGSMTVQSGRSKFSLQCLPESDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEE--DLKLCAVATDG 178
                + +SF+L ++ LK L++RT FA++TEE RYYLNGIFFH  E   +LKL AVATDG
Sbjct: 120 LTAGTFTHSFKLKATDLKMLIDRTQFAISTEETRYYLNGIFFHTIESKGELKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA A+VD  +    MP II+PRK VGE+ +++ + ++ V V +S+++I + I S+ ++
Sbjct: 180 HRLARADVDAPSGSEGMPGIIIPRKTVGELQKLVDNPEAIVTVEVSDAKIRMTIGSIVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDKE+RV+CT+  QAVDRVS +SS R +AVKL+LS  +L +T
Sbjct: 240 SKLIDGTFPDYQRVIPTGNDKEMRVDCTSFAQAVDRVSTISSERGRAVKLALSEGQLMLT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A E + V Y+   M+I FN KYLL+I   +S      +E +F L  + S   
Sbjct: 300 VNNPDSGSATEEVAVGYDTDAMEIGFNAKYLLDITAQLSG-----EEAIFLLADAGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           IR    D         +A YVLMPMR+
Sbjct: 355 IRDTAGD---------DALYVLMPMRV 372


>gi|222084599|ref|YP_002543128.1| DNA polymerase III, beta subunit [Agrobacterium radiobacter K84]
 gi|221722047|gb|ACM25203.1| DNA polymerase III, beta subunit [Agrobacterium radiobacter K84]
          Length = 372

 Score =  361 bits (926), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 187/387 (48%), Positives = 257/387 (66%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+IT+ERS++L+ L H  R++ER+NTIP+  +VLL+A    L++KA+  ++EIT A PA+
Sbjct: 1   MRITIERSNLLKSLNHVHRVVERRNTIPILSNVLLKAEGANLDMKATDLDLEITEATPAN 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DG+++     N  G  + ++ G S F LQ  PES+FP 
Sbjct: 61  VEQAGATTVPAHLLYDIVRKLPDGSEV-LLATNPDGGSMTVASGRSKFSLQCLPESDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
                + +SF+L ++ LK L++RT FA++TEE RYYLNGIFFH   +E DLKL AVATDG
Sbjct: 120 LTAGSFSHSFKLKAADLKMLIDRTQFAISTEETRYYLNGIFFHTIESEGDLKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA A+V   +    MP II+PRK VGE+ +++ S D  V V +S+++I   I S+ M+
Sbjct: 180 HRLARADVSAPSGSEGMPGIIIPRKTVGELQKLVDSPDVIVTVEVSDAKIRTTIGSIVMT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP +NDKE+RV+C +  QAVDRVS +SS R +AVKL+LS  +L +T
Sbjct: 240 SKLIDGTFPDYQRVIPTNNDKEMRVDCQSFAQAVDRVSTISSERGRAVKLALSDGQLLLT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A E + V Y+   M+I FN KYLL+I   +S      D  +F L  + S   
Sbjct: 300 VNNPDSGSATEEVAVGYDTDAMEIGFNAKYLLDITAQLSG-----DAAIFLLADAGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           IR    D         +A YVLMPMR+
Sbjct: 355 IRDTAGD---------DALYVLMPMRV 372


>gi|227824176|ref|YP_002828149.1| DNA polymerase III subunit beta [Sinorhizobium fredii NGR234]
 gi|227343178|gb|ACP27396.1| DNA polymerase III, beta subunit [Sinorhizobium fredii NGR234]
          Length = 372

 Score =  358 bits (918), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 182/387 (47%), Positives = 257/387 (66%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+IT+ERS++L+ L H  R++ER+NTIP+  +VLL+++   LE+KA+  ++EIT A PA 
Sbjct: 1   MRITLERSNLLKSLNHVHRVVERRNTIPILSNVLLRSDGASLEMKATDLDLEITEATPAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DG+++      E GT + ++ G S F LQ  P+S+FP 
Sbjct: 61  VEQAGATTVPAHLLYDIVRKLPDGSEVRLATNAE-GTAMTVASGRSKFSLQCLPQSDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
                + +SF L ++ LK L++RT FA++TEE RYYLNGIF H   N+ +LKL AVATDG
Sbjct: 120 LTAGSFSHSFRLKATDLKMLIDRTQFAISTEETRYYLNGIFVHTVENKGELKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA A+++  A    MP II+PRK V E+ ++L + D  V   +S+++I L I S+ M+
Sbjct: 180 HRLARADIEAPAGSEGMPGIIIPRKTVSELQKLLDTPDVVVTAEVSDAKIRLTIGSIVMT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDKELRV+C +  QAVDRVS +SS R +AVKL+L+  ++ +T
Sbjct: 240 SKLIDGTFPDYQRVIPAGNDKELRVDCQSFAQAVDRVSTISSERGRAVKLALTDGQMTLT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A+E + V Y   P++I FN KYLL+I     + ++  +E VF L    S   
Sbjct: 300 VNNPDSGSAMEELPVGYENDPLEIGFNAKYLLDI-----TAQLTGNEAVFMLADPGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R    D         +A YVLMPMR+
Sbjct: 355 VRDLAAD---------DALYVLMPMRV 372


>gi|307301232|ref|ZP_07580994.1| DNA polymerase III, beta subunit [Sinorhizobium meliloti BL225C]
 gi|307317903|ref|ZP_07597340.1| DNA polymerase III, beta subunit [Sinorhizobium meliloti AK83]
 gi|306896305|gb|EFN27054.1| DNA polymerase III, beta subunit [Sinorhizobium meliloti AK83]
 gi|306903688|gb|EFN34275.1| DNA polymerase III, beta subunit [Sinorhizobium meliloti BL225C]
          Length = 372

 Score =  357 bits (917), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 185/387 (47%), Positives = 255/387 (65%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+IT+ERS++L+ L H  R++ER+NTIP+  +VLL+++   LE+KA+  ++EIT A PA 
Sbjct: 1   MRITLERSNLLKSLNHVHRVVERRNTIPILSNVLLRSDGASLEMKATDLDLEITEATPAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DG+++      E GT + ++ G S F LQ  P+S+FP 
Sbjct: 61  VEQAGATTVPAHLLYDIVRKLPDGSEVRLATNAE-GTAMTVASGRSKFSLQCLPQSDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEE--DLKLCAVATDG 178
                + +SF L +  LK L++RT FA++TEE RYYLNGIF H  E   DLKL AVATDG
Sbjct: 120 LTAGTFSHSFRLKAPDLKMLIDRTQFAISTEETRYYLNGIFVHTVESNGDLKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA A+V+  +    MP II+PRK V E+ ++L S D  V V +S+++I L I S+ M+
Sbjct: 180 HRLARADVEAPSGSEGMPGIIIPRKTVSELQKLLDSPDVVVTVEVSDAKIRLTIGSIVMT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP SNDKELRV+C +  QAVDRVS +SS R +AVKL+L+  ++ +T
Sbjct: 240 SKLIDGTFPDYQRVIPASNDKELRVDCQSFSQAVDRVSTISSERGRAVKLALADGQMTLT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A E + V Y   P++I FN KYLL+I     + ++   E VF L    S   
Sbjct: 300 VNNPDSGSATEELPVGYESDPLEIGFNAKYLLDI-----TGQLTGSEAVFLLADPGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R    +         +A YVLMPMR+
Sbjct: 355 VRDLAAE---------DALYVLMPMRV 372


>gi|15964088|ref|NP_384441.1| DNA polymerase III subunit beta [Sinorhizobium meliloti 1021]
 gi|15073264|emb|CAC41772.1| Probable DNA polymerase III, beta chain [Sinorhizobium meliloti
           1021]
          Length = 372

 Score =  357 bits (916), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 185/387 (47%), Positives = 255/387 (65%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+IT+ERS++L+ L H  R++ER+NTIP+  +VLL+++   LE+KA+  ++EIT A PA 
Sbjct: 1   MRITLERSNLLKSLNHVHRVVERRNTIPILSNVLLRSDGASLEMKATDLDLEITEATPAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DG+++      E GT + ++ G S F LQ  P+S+FP 
Sbjct: 61  VEQAGATTVPAHLLYDIVRKLPDGSEVRLATNAE-GTAMTVASGRSKFSLQCLPQSDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEE--DLKLCAVATDG 178
                + +SF L +  LK L++RT FA++TEE RYYLNGIF H  E   DLKL AVATDG
Sbjct: 120 LTAGTFSHSFRLKAPDLKMLIDRTQFAISTEETRYYLNGIFVHTVESNGDLKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA A+V+  +    MP II+PRK V E+ ++L S D  V V +S+++I L I S+ M+
Sbjct: 180 HRLARADVEAPSGSEGMPGIIIPRKTVSELQKLLDSPDVVVTVEVSDAKIRLTIGSIVMT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP SNDKELRV+C +  QAVDRVS +SS R +AVKL+L+  ++ +T
Sbjct: 240 SKLIDGTFPDYQRVIPASNDKELRVDCQSFSQAVDRVSTISSERGRAVKLALADGQMTLT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A E + V Y   P++I FN KYLL+I     + ++   E VF L    S   
Sbjct: 300 VNNPDSGSATEELPVGYESDPLEIGFNAKYLLDI-----TGQLTGGEAVFLLADPGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R    +         +A YVLMPMR+
Sbjct: 355 VRDLAAE---------DALYVLMPMRV 372


>gi|163757766|ref|ZP_02164855.1| DNA polymerase III subunit beta [Hoeflea phototrophica DFL-43]
 gi|162285268|gb|EDQ35550.1| DNA polymerase III subunit beta [Hoeflea phototrophica DFL-43]
          Length = 372

 Score =  355 bits (912), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 181/387 (46%), Positives = 253/387 (65%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T+ERS++L+ L H  R++ER+NTIP+  +VLL+A    L++KA+  ++EIT A PA 
Sbjct: 1   MRVTLERSNLLKSLNHVHRVVERRNTIPILSNVLLKAEGATLDMKATDLDLEITEATPAM 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           ++  GS TV AHLLYDIVRKL DG+++     N  G  + ++ G S F LQ  PES+FP 
Sbjct: 61  IEQAGSTTVPAHLLYDIVRKLSDGSEV-MLATNPDGASMTVASGRSKFTLQCLPESDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
                + ++F L ++ LK L++RT FA++TEE RYYLNGIF H   +E  LKL AVATDG
Sbjct: 120 LTAGAFSHTFRLPATELKMLIDRTQFAISTEETRYYLNGIFVHTIESEGALKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA A+VD  +    MP II+PRK VGEI +++ + D +V V +S+++I   I S+ M+
Sbjct: 180 HRLARADVDAPSGSEGMPGIIIPRKTVGEIQKLVDNPDLTVTVEVSDAKIRFTIGSVVMT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDKEL V+C    QAVDRVS +SS R +AVKL+++  +L +T
Sbjct: 240 SKLIDGTFPDYQRVIPTGNDKELTVDCQTFAQAVDRVSTISSERGRAVKLAIADGQLTLT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A E + V Y+  P++I FN KYLL+I + +S       + VF L    S   
Sbjct: 300 VNNPDSGSATEELAVGYDRDPIEIGFNAKYLLDITNQLSG-----TDAVFLLADPGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R    D         +A YVLMPMR+
Sbjct: 355 VRDTAGD---------DALYVLMPMRV 372


>gi|325291735|ref|YP_004277599.1| DNA polymerase III beta subunit [Agrobacterium sp. H13-3]
 gi|325059588|gb|ADY63279.1| DNA polymerase III beta subunit [Agrobacterium sp. H13-3]
          Length = 378

 Score =  353 bits (906), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 179/387 (46%), Positives = 259/387 (66%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+IT+ERS++L+ L H  R++ER+NTIP+  +VLL+A+   L++KA+  ++EIT A PA 
Sbjct: 7   MRITLERSNLLKSLNHVHRVVERRNTIPILSNVLLRASGANLDMKATDLDLEITEATPAM 66

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLY+IVRKL DG+++     N  G+ + ++ G S F LQ  PE++FP 
Sbjct: 67  VEQAGATTVPAHLLYEIVRKLPDGSEV-LLATNPDGSTMTVASGRSKFSLQCLPETDFPD 125

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEE--DLKLCAVATDG 178
                + ++F+L ++ LK L++RT FA++TEE RYYLNGIFFH  E   DLKL AVATDG
Sbjct: 126 LTAGTFSHTFKLKATDLKMLIDRTQFAISTEETRYYLNGIFFHTIESNGDLKLRAVATDG 185

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA A+VD  +    MP II+PRK VGE+ +++ + +  V V +S+++I L I S+ ++
Sbjct: 186 HRLARADVDAPSGSEGMPGIIIPRKTVGELQKLMDNPELDVTVEVSDAKIRLTIGSVVLT 245

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDKE+RV+C    +AVDRVS +SS R +AVKL+L++ +L +T
Sbjct: 246 SKLIDGTFPDYQRVIPTGNDKEMRVDCQTFARAVDRVSTISSERGRAVKLALTNGQLTLT 305

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A E + V Y+   M+I FN KYLL+I   +S      ++ +F L  + S   
Sbjct: 306 VNNPDSGSATEEVAVGYDNDSMEIGFNAKYLLDITSQLSG-----EDAIFLLADAGSPTL 360

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R    D         +A YVLMPMR+
Sbjct: 361 VRDTAGD---------DALYVLMPMRV 378


>gi|150398727|ref|YP_001329194.1| DNA polymerase III subunit beta [Sinorhizobium medicae WSM419]
 gi|150030242|gb|ABR62359.1| DNA polymerase III, beta subunit [Sinorhizobium medicae WSM419]
          Length = 372

 Score =  353 bits (905), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 183/387 (47%), Positives = 255/387 (65%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+IT+ERS++L+ L H  R++ER+NTIP+  +VLL+++   LE+KA+  ++EIT A  A 
Sbjct: 1   MRITLERSNLLKSLNHVHRVVERRNTIPILSNVLLRSDGASLEMKATDLDLEITEATQAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DG+++     N  GT + ++ G S F LQ  P+S+FP 
Sbjct: 61  VEQAGATTVPAHLLYDIVRKLPDGSEV-LLATNAEGTAMTVASGRSKFSLQCLPQSDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEE--DLKLCAVATDG 178
                + +SF L ++ LK L++RT FA++TEE RYYLNGIF H  E   +LKL AVATDG
Sbjct: 120 LTAGTFSHSFRLKATDLKMLIDRTQFAISTEETRYYLNGIFVHTVESNGELKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA A+V+  +    MP II+PRK V E+ ++L + D  V V +S+++I L I S+ M+
Sbjct: 180 HRLARADVEAPSGSEGMPGIIIPRKTVSELQKLLDNPDVVVTVEVSDAKIRLTIGSIVMT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP SNDKELRV+C +  QAVDRVS +SS R +AVKL+L+  ++ +T
Sbjct: 240 SKLIDGTFPDYQRVIPASNDKELRVDCQSFSQAVDRVSTISSERGRAVKLALTDGQMTLT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A E + V Y   P++I FN KYLL+I     + ++   E VF L    S   
Sbjct: 300 VNNPDSGSATEEVPVGYESDPLEIGFNAKYLLDI-----TAQLTGSEAVFLLADPGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R    D         +A YVLMPMR+
Sbjct: 355 VRDLAAD---------DALYVLMPMRV 372


>gi|159184247|ref|NP_353331.2| DNA polymerase III subunit beta [Agrobacterium tumefaciens str.
           C58]
 gi|159139574|gb|AAK86116.2| DNA polymerase III, beta chain [Agrobacterium tumefaciens str. C58]
          Length = 372

 Score =  349 bits (896), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 178/387 (45%), Positives = 258/387 (66%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+IT+ERS++L+ L H  R++ER+NTIP+  +VLL+A+   L++KA+  ++EIT A PA 
Sbjct: 1   MRITLERSNLLKSLNHVHRVVERRNTIPILSNVLLRASGANLDMKATDLDLEITEATPAM 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLY+IVRKL DG+++     N  G+ + ++ G S F LQ  PE++FP 
Sbjct: 61  VEQAGATTVPAHLLYEIVRKLPDGSEV-LLATNPDGSSMTVASGRSKFSLQCLPEADFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEE--DLKLCAVATDG 178
                + ++F+L ++ LK L++RT FA++TEE RYYLNGIFFH  E   +LKL AVATDG
Sbjct: 120 LTAGTFSHTFKLKAADLKMLIDRTQFAISTEETRYYLNGIFFHTIESNGELKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA A+VD  +    MP II+PRK VGE+ +++ + +  V V +S+++I L I S+ ++
Sbjct: 180 HRLARADVDAPSGSEGMPGIIIPRKTVGELQKLMDNPELEVTVEVSDAKIRLAIGSVVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDKE+RV+C    +AVDRVS +SS R +AVKL+L+  +L +T
Sbjct: 240 SKLIDGTFPDYQRVIPTGNDKEMRVDCQTFARAVDRVSTISSERGRAVKLALTDGQLTLT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A E + V Y+   M+I FN KYLL+I   +S      ++ +F L  + S   
Sbjct: 300 VNNPDSGSATEEVAVGYDNDSMEIGFNAKYLLDITSQLSG-----EDAIFLLADAGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R    D         +A YVLMPMR+
Sbjct: 355 VRDTAGD---------DALYVLMPMRV 372


>gi|218673040|ref|ZP_03522709.1| DNA polymerase III subunit beta [Rhizobium etli GR56]
          Length = 361

 Score =  347 bits (889), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 179/374 (47%), Positives = 248/374 (66%), Gaps = 17/374 (4%)

Query: 14  LGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPASVDVCGSITVSAHL 73
           L H  R++ER+NTIP+  +VLL+A+   L++KA+  ++EIT A PASV+  G+ TV AHL
Sbjct: 3   LNHVHRVVERRNTIPILSNVLLKADGQNLDMKATDLDLEITEATPASVEQAGATTVPAHL 62

Query: 74  LYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPSTKEEEYVYSFELA 133
           LYDIVRKL DG+++     +  G  + +  G S F LQ  PES+FP      + +SF+L 
Sbjct: 63  LYDIVRKLSDGSEV-LLATSPDGGSMTVQSGRSKFSLQCLPESDFPDLTAGTFTHSFKLK 121

Query: 134 SSVLKNLVERTHFAMATEEIRYYLNGIFFHINEE--DLKLCAVATDGHRLAVAEVDIVAQ 191
           +S LK L++RT FA++TEE RYYLNGIFFH  E   +LKL AVATDGHRLA A+VD  + 
Sbjct: 122 ASDLKMLIDRTQFAISTEETRYYLNGIFFHTIESKGELKLRAVATDGHRLARADVDAPSG 181

Query: 192 IAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLIDGEFPNYQN 251
              MP II+PRK VGE+ +++ + ++ V V +S+++I + I S+ ++ +LIDG FP+YQ 
Sbjct: 182 SEGMPGIIIPRKTVGELQKLVDNPEAIVTVEVSDAKIRMTIGSIVLTSKLIDGTFPDYQR 241

Query: 252 VIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPDMGKAIESM 311
           VIP  NDKE+RV+CT+  QAVDRVS +SS R +AVKL+LS  +L +TV+NPD G A E +
Sbjct: 242 VIPTGNDKEMRVDCTSFAQAVDRVSTISSERGRAVKLALSEGQLMLTVNNPDSGSATEEV 301

Query: 312 NVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIRGKDKDSKNNKD 371
            V Y+   M+I FN KYLL+I   +S      +E +F L  + S   IR    D      
Sbjct: 302 AVGYDTDAMEIGFNAKYLLDITAQLSG-----EEAIFLLADAGSPTLIRDTAGD------ 350

Query: 372 NKVNAFYVLMPMRI 385
              +A YVLMPMR+
Sbjct: 351 ---DALYVLMPMRV 361


>gi|110632364|ref|YP_672572.1| DNA polymerase III subunit beta [Mesorhizobium sp. BNC1]
 gi|110283348|gb|ABG61407.1| DNA polymerase III, beta subunit [Chelativorans sp. BNC1]
          Length = 372

 Score =  345 bits (886), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 180/387 (46%), Positives = 255/387 (65%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++ +ERS++L+ LGH  R++ER+NTIP+  +VLL A+   LE+KA+  ++E+T A PAS
Sbjct: 1   MRVVLERSNLLKSLGHVHRVVERRNTIPILSNVLLSADGASLEMKATDLDLEMTEAAPAS 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DGA++   K +E G  +++  G S F LQ  P+++FP+
Sbjct: 61  VEQGGATTVPAHLLYDIVRKLPDGAEV-MLKVDENGQTMSVISGRSTFRLQCLPKADFPA 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
               ++ + F + S+VL++LVE+T FA++TEE RYYLNGIF H  E D  LKL AVATDG
Sbjct: 120 LTAGQFSHIFRMESAVLRSLVEKTQFAISTEETRYYLNGIFLHTLESDGALKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AE++  A    MP IIVPRK VGE+ +++   D +V V LS+++I   I S+ ++
Sbjct: 180 HRLARAEIEAPAGSEGMPGIIVPRKTVGELQKLVDDPDVAVTVELSDTKIRFTIGSVVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDKEL ++  +   AVDRVS +SS R +AVKLS+S  ++  T
Sbjct: 240 SKLIDGTFPDYQRVIPVGNDKELLIDRQSFSAAVDRVSTVSSERGRAVKLSISDGQVTFT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A E +   YN  P++I FN +YLL++   +S       E  F L  + S   
Sbjct: 300 VNNPDSGSATEEIPAGYNADPIEIGFNARYLLDVAAQLSG-----SEAKFLLADAGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           I       ++  D +V   YVLMPMR+
Sbjct: 355 I-------QDTSDERV--LYVLMPMRV 372


>gi|222147282|ref|YP_002548239.1| DNA polymerase III subunit beta [Agrobacterium vitis S4]
 gi|221734272|gb|ACM35235.1| DNA polymerase III beta subunit [Agrobacterium vitis S4]
          Length = 412

 Score =  342 bits (878), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 178/387 (45%), Positives = 251/387 (64%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+IT+ERS++L+ L H  R++ER+NTIP+  +VLL+A    L +KA+  ++E+T A PA+
Sbjct: 41  MRITLERSNLLKSLNHVHRVVERRNTIPILSNVLLRAEGQSLSMKATDLDLEVTEATPAN 100

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           ++  G+ TV AHLLY+IVRKL DGA++     N  G  + ++ G S F LQ  PE +FP 
Sbjct: 101 IEQAGATTVPAHLLYEIVRKLSDGAEV-LLSTNPDGASMTVASGRSKFSLQCLPEQDFPD 159

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
                + +SF+L +S LK L++RT FA++TEE RYYLNGI+ H  E D  LKL AVATDG
Sbjct: 160 LTTGSFSHSFKLKASDLKMLIDRTQFAISTEETRYYLNGIYLHTIEADGKLKLRAVATDG 219

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA A+V+  +    MP II+PRK VGE+ +++ + D  V + +S+++I  NI  + M+
Sbjct: 220 HRLARADVEAPSGSEGMPGIIIPRKTVGELQKLVDNPDLIVALEVSDAKIRFNIGEIVMT 279

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP +NDKE+RV+C    +AVDRVS +SS R +AVKL++    L +T
Sbjct: 280 SKLIDGTFPDYQRVIPQANDKEMRVDCQTFARAVDRVSTISSERGRAVKLAIGDGHLMLT 339

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A E + V Y    M+I FN KYLL+I   +S      +E +F L  + S   
Sbjct: 340 VNNPDSGSATEEVAVGYESDAMEIGFNAKYLLDITAQLSG-----EEAIFLLADAGSPTL 394

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           IR    D         +A YVLMPMR+
Sbjct: 395 IRDTAGD---------DALYVLMPMRV 412


>gi|118590459|ref|ZP_01547861.1| DNA polymerase III subunit beta [Stappia aggregata IAM 12614]
 gi|118436922|gb|EAV43561.1| DNA polymerase III subunit beta [Stappia aggregata IAM 12614]
          Length = 372

 Score =  339 bits (870), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 176/388 (45%), Positives = 256/388 (65%), Gaps = 19/388 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ER+D+L+ L H  R++ER+NTIP+  +VLL+A+ G + +KA+  ++EI  ++PA 
Sbjct: 1   MKATLERTDLLKSLTHVHRVVERRNTIPILSNVLLRADGGAINLKATDLDLEIVESVPAM 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           +++ G+ TV AH+ YDIVRKL +G+Q+     ++  T + I  G S F LQ  PE++FP 
Sbjct: 61  IEMPGATTVPAHMFYDIVRKLPEGSQVVLETTSDNAT-LEIRAGRSKFTLQMLPETDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINE--EDLKLCAVATDG 178
               ++ +SF L  + ++ L++ T FA++TEE RYYLNGI+ H  +    L+  AVATDG
Sbjct: 120 LTAGDFSHSFSLTGADIRKLIDATQFAISTEETRYYLNGIYLHTVDAGSGLQFRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AEV   +  A MP IIVPRK VGEI ++L S ++SV+V LS+++I L   S+ ++
Sbjct: 180 HRLAQAEVPAPSGSAGMPGIIVPRKTVGEIQKLLESPEASVQVELSDTKIRLTTGSVILT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP +NDKE+RV+    ++AVDRVS +SS R +AVKLSL+   L +T
Sbjct: 240 SKLIDGTFPDYGRVIPQNNDKEMRVDRDEFKEAVDRVSTISSERGRAVKLSLTEGHLVLT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A E + V Y+  P+DI FN +YLL+I + +SS     D  +FRL  S S   
Sbjct: 300 VNNPDSGSATEELAVEYDAEPLDIGFNSRYLLDIANQLSS-----DTALFRLADSGSPTL 354

Query: 359 IRGKDKDSKNNKDNKV-NAFYVLMPMRI 385
           I          +DN V +  +VLMPMR+
Sbjct: 355 I----------QDNTVDDCLFVLMPMRV 372


>gi|86747129|ref|YP_483625.1| DNA polymerase III subunit beta [Rhodopseudomonas palustris HaA2]
 gi|86570157|gb|ABD04714.1| DNA polymerase III, beta subunit [Rhodopseudomonas palustris HaA2]
          Length = 372

 Score =  339 bits (869), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 178/387 (45%), Positives = 245/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+TVER+ +L+ LGH  R++ER+NTIP+  +VL++A +  L +KA+  ++E+T  +PA 
Sbjct: 1   MKVTVERAQLLKSLGHVHRVVERRNTIPILGNVLVRAENAQLSLKATDLDLEVTETLPAE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               GS TV AH+ YDIVRKL DG+QI    + +    + I  G S F LQ+ PES+FP 
Sbjct: 61  TATAGSTTVPAHMFYDIVRKLPDGSQIVLESDGDRSV-LAIRAGRSRFTLQTLPESDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
               E  +SF L +S +K L++RT FA++TEE RYYLNGI+ H   + +D KL AVATDG
Sbjct: 120 LAAGEMSHSFSLTASDVKRLIDRTQFAISTEETRYYLNGIYLHTAGSAKDAKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  ++   A  A MP +IVPRK VGE+ R++   D+ + + LS  +I   I ++ ++
Sbjct: 180 HRLAQVDLTQPAGAAGMPGVIVPRKTVGEVQRLIEDNDAEIGLELSVGKIRFTIGNVVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP +NDKEL V+  +   AVDRVS +SS R +AVKL+LS+ KL ++
Sbjct: 240 SKLIDGTFPDYGRVIPQNNDKELVVDKKDFEAAVDRVSTISSERGRAVKLALSAGKLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V NPD G A E + V Y   P+DI FN +YLL+I   I   EV     V RL    S   
Sbjct: 300 VTNPDSGSATEELEVEYASDPLDIGFNSRYLLDIAAQIEG-EV----AVLRLADPGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           I+ +DK          NA YVLMPMR+
Sbjct: 355 IQDRDKK---------NALYVLMPMRV 372


>gi|307942711|ref|ZP_07658056.1| DNA polymerase III, beta subunit [Roseibium sp. TrichSKD4]
 gi|307773507|gb|EFO32723.1| DNA polymerase III, beta subunit [Roseibium sp. TrichSKD4]
          Length = 372

 Score =  333 bits (855), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 175/388 (45%), Positives = 247/388 (63%), Gaps = 19/388 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ER+D+L+ L H  R++ER+NTIP+  +VLL+A+ G L +KA+  ++EI  +IPA 
Sbjct: 1   MKATLERTDLLKSLTHVHRVVERRNTIPILSNVLLRADGGSLNLKATDLDLEIVESIPAM 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V++ G+ TV AH+ YDIVRKL DG+Q+      +  T + I  G S F LQ  PES+FP 
Sbjct: 61  VEMGGATTVPAHMFYDIVRKLPDGSQVVLETTGDNST-LEIRAGRSRFTLQMLPESDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
               ++ + F L +  ++ L++ T FA++TEE RYYLNGI+ H        +  AVATDG
Sbjct: 120 LTAGDFSHGFALTAGDIRKLIDTTQFAISTEETRYYLNGIYLHTVNTPSGERFRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AEV        MP IIVPRK VGEI ++L   D++V++ LSE++I +   ++ ++
Sbjct: 180 HRLAQAEVTAPNGSHGMPGIIVPRKTVGEIQKLLEEPDANVQIELSETKIRITTGAVVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP  NDKE+RV+    ++AVDRVS +SS R +AVKLSLS  ++ +T
Sbjct: 240 SKLIDGTFPDYGRVIPQGNDKEMRVDRDEFKEAVDRVSTISSERGRAVKLSLSDGRMVLT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A E + V Y    MDI FN +YLL+I + +SS     D  +FRL  S S   
Sbjct: 300 VNNPDSGSATEELAVEYTSDAMDIGFNSRYLLDIANQLSS-----DTALFRLADSGSPTL 354

Query: 359 IRGKDKDSKNNKDNKV-NAFYVLMPMRI 385
           I          +DN V +  +VLMPMR+
Sbjct: 355 I----------QDNTVDDCLFVLMPMRV 372


>gi|115522032|ref|YP_778943.1| DNA polymerase III subunit beta [Rhodopseudomonas palustris BisA53]
 gi|115515979|gb|ABJ03963.1| DNA polymerase III, beta subunit [Rhodopseudomonas palustris
           BisA53]
          Length = 372

 Score =  332 bits (851), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 174/387 (44%), Positives = 244/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+TVER+ +L+ LGH  R++ER+NTIP+  +VL++A  G L +KA+  ++E+T ++PA 
Sbjct: 1   MKVTVERAQLLKSLGHVHRVVERRNTIPILGNVLVRAEKGRLSLKATDLDLEVTESLPAE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               G+ TV AH+ YDIVRKL DG+QI    + E    + I  G S F LQ+ PE++FP 
Sbjct: 61  TATPGATTVPAHMFYDIVRKLPDGSQIVLESDGERAV-LAIRAGRSRFTLQTLPETDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDL--KLCAVATDG 178
               E  +SF L +S +K L++RT FA++TEE RYYLNGI+ H     +   L AVATDG
Sbjct: 120 LAAGEMTHSFALPASDVKRLIDRTQFAISTEETRYYLNGIYLHSAGSAVAATLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  ++ + +  A MP +IVPRK VGE+ R++   + SV + LS ++I   I  + ++
Sbjct: 180 HRLAQLDLPLPSGAAGMPGVIVPRKTVGEVQRLIEDSEVSVGIELSTNKIRFTIGDVVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP +NDKEL V+ T+   AVDRVS +SS R +AVKL+LS+ KL ++
Sbjct: 240 SKLIDGTFPDYGRVIPQNNDKELVVDKTDFEAAVDRVSTISSERGRAVKLALSAGKLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V NPD G A E + V Y    +DI FN +YLL+I   I       +  V RL    S   
Sbjct: 300 VTNPDSGSATEELEVEYASDALDIGFNSRYLLDIAAQIEG-----EAAVLRLADPGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           I  +D+D+K        A YVLMPMR+
Sbjct: 355 I--QDRDAK-------GALYVLMPMRV 372


>gi|304392440|ref|ZP_07374381.1| DNA polymerase III, beta subunit [Ahrensia sp. R2A130]
 gi|303295544|gb|EFL89903.1| DNA polymerase III, beta subunit [Ahrensia sp. R2A130]
          Length = 371

 Score =  330 bits (845), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 173/387 (44%), Positives = 245/387 (63%), Gaps = 18/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T+ER+++L+ L H  R++ER+NTIP+  +VLL+A DG L +KA+  ++E+T    A 
Sbjct: 1   MRLTLERANLLKSLNHVQRVVERRNTIPILSNVLLKAEDGGLMLKATDLDLEVTEKTTAE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TVSAH LYDIVRKL DG+Q+    +   G  + +  G S F LQ  PES+FP 
Sbjct: 61  VEQSGATTVSAHTLYDIVRKLPDGSQVLLAVDESNG--LLVRAGRSQFRLQMLPESDFPD 118

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK--LCAVATDG 178
               E+ ++F +  +  K L++RT FA++TEE RYYLNGI+ H  E D K  L AVATDG
Sbjct: 119 LTAAEFTHTFRMGCADFKALIDRTQFAISTEETRYYLNGIYLHAVEADGKEMLRAVATDG 178

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA A+ +     + MP IIVPRK VGEI ++L   D+ V V LS+S+I   +  + ++
Sbjct: 179 HRLAQAQTEAPDGASGMPGIIVPRKTVGEIQKLLEDPDAFVTVELSDSKIRFTVGEVVLT 238

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP  N KEL ++      AVDRVS ++S R +AVKLS+S  +L ++
Sbjct: 239 SKLIDGTFPDYNRVIPSGNTKELLLDRATFSSAVDRVSTIASDRGRAVKLSISDGQLTLS 298

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A E + V Y++  MDI FN +YLL+I + +S+     +E  F L  + S   
Sbjct: 299 VNNPDSGSAEEELAVGYSDDDMDIGFNSRYLLDITNQLSA-----EETTFMLADAGSPTL 353

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           IR K +D          A YVLMPMR+
Sbjct: 354 IREKGQD---------GALYVLMPMRV 371


>gi|90420503|ref|ZP_01228410.1| DNA polymerase III, beta subunit [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335231|gb|EAS48984.1| DNA polymerase III, beta subunit [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 374

 Score =  329 bits (844), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 175/389 (44%), Positives = 249/389 (64%), Gaps = 19/389 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+I +ERS++L+ L H  R++ER+NTIP+  +VLL+     L +KA+  ++EIT + PA+
Sbjct: 1   MRIIIERSNLLKSLAHVHRVVERRNTIPILSNVLLKTEGEGLRLKATDLDLEITESAPAT 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
            +  G+ TV AHLLYDIVRKL DGA++S     E GT++ +S G SNF LQ  PES+FP 
Sbjct: 61  GEQEGATTVPAHLLYDIVRKLPDGAEVSLATNAE-GTQMTVSSGRSNFRLQCLPESDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
                  ++F+L ++ L  L+ERT FA++TEE RYYLNGI+ H  E D  L+L AVATDG
Sbjct: 120 ITAGTLSHAFKLKAAELGRLIERTQFAISTEETRYYLNGIYLHTIEADGDLQLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRIL--SSKDSSVKVSLSESRIHLNIESLS 236
           HRLA A+    A    MP II+PRK VGE+ ++L  S+ ++ + V LS+++I   I ++ 
Sbjct: 180 HRLARADQKAPAGSEGMPGIIIPRKTVGELQKLLGDSNDEAEISVELSDAKIRFTIGAVV 239

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
           M+ +LIDG FP+YQ VIP +NDK L ++      AVDRVS +SS R +AVKL+++  +L 
Sbjct: 240 MTSKLIDGTFPDYQRVIPQNNDKALTLDRQTFSAAVDRVSTISSERGRAVKLAVADSQLV 299

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           +TV++PD G A E + V Y+   ++I FN KYLL+I + +S      DE VF L    S 
Sbjct: 300 LTVNSPDSGTATEELAVGYDSDEIEIGFNAKYLLDITNQLSG-----DETVFMLADPGSP 354

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             I+    D+           YVLMPMR+
Sbjct: 355 TLIKDGGDDA---------TLYVLMPMRV 374


>gi|254502919|ref|ZP_05115070.1| DNA polymerase III, beta subunit [Labrenzia alexandrii DFL-11]
 gi|222438990|gb|EEE45669.1| DNA polymerase III, beta subunit [Labrenzia alexandrii DFL-11]
          Length = 375

 Score =  329 bits (844), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 167/388 (43%), Positives = 252/388 (64%), Gaps = 19/388 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ER+D+L+ L H  R++ER+NTIP+  +VLL+A+ G L +KA+  ++EI   +PA 
Sbjct: 4   MKATLERTDLLKSLTHVHRVVERRNTIPILSNVLLRADGGALNLKATDLDLEIVETVPAM 63

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           +++ G+ TV AH+ +DIVRKL +G+Q+      +  T + I  G S F LQ  PE++FP 
Sbjct: 64  IEMPGATTVPAHMFFDIVRKLPEGSQVVLETTGD-DTTLEIRAGRSKFTLQMLPETDFPD 122

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINE--EDLKLCAVATDG 178
               ++ + F L++S ++ L++ T FA++TEE RYYLNGI+ H  +     +  AVATDG
Sbjct: 123 LTAGDFSHGFTLSASDIRKLIDTTQFAISTEETRYYLNGIYLHTVDAANGQQFRAVATDG 182

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AEV   +  + MP IIVPRK VGEI ++L + ++ V++ LS+++I +  +++ ++
Sbjct: 183 HRLAQAEVSAPSGSSGMPGIIVPRKTVGEIQKLLENPEADVQIELSDTKIRITTDTVVLT 242

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP  NDKE+RV+    ++AVDRVS +SS R +AVKL+L   +L +T
Sbjct: 243 SKLIDGTFPDYGRVIPQGNDKEMRVDRDEFKEAVDRVSTISSERGRAVKLALGDGRLVLT 302

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A E + V Y   P++I FN +YLL+I + +SS     D  +FRL  S S   
Sbjct: 303 VNNPDSGSATEELAVEYESDPLEIGFNSRYLLDIANQLSS-----DTALFRLADSGSPTL 357

Query: 359 IRGKDKDSKNNKDNKV-NAFYVLMPMRI 385
           I          +DN V +  +VLMPMR+
Sbjct: 358 I----------QDNTVDDCLFVLMPMRV 375


>gi|319779751|ref|YP_004139227.1| DNA polymerase III, subunit beta [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317165639|gb|ADV09177.1| DNA polymerase III, beta subunit [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 372

 Score =  328 bits (841), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 170/387 (43%), Positives = 246/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++ +ERS++L+ L H  R++ER+NTIP+  +VLL A    LE+KA+  ++E+T A PA 
Sbjct: 1   MRVILERSNLLKSLNHVHRVVERRNTIPILSNVLLGAEGASLEMKATDLDLEVTEATPAK 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DGA++   K +E G  + ++ G S+F LQ  P+S+FP 
Sbjct: 61  VERGGATTVPAHLLYDIVRKLADGAEV-MLKTDEDGNAMTVTSGRSSFRLQCLPQSDFPE 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINE--EDLKLCAVATDG 178
                + + F L S  LK L+E+T FA++TEE RYYLNGI+ H +E    LKL +VATDG
Sbjct: 120 LSAGSFSHIFRLDSVALKGLIEKTQFAISTEETRYYLNGIYLHTHEVGGKLKLRSVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AE+D  A    MP II+PRK V E+ +++   D +V   LS+++I   I S+ ++
Sbjct: 180 HRLARAEIDAPAGSEGMPGIIIPRKTVSELQKLVDDPDVAVTTELSDTKIRFTIGSVVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDK+L ++  +   AVDRVS +SS R +AVKLS+S  ++ + 
Sbjct: 240 SKLIDGTFPDYQRVIPTGNDKKLIIDRQSFAAAVDRVSTISSERGRAVKLSISEGQVTLA 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A E ++  Y+  P++I FN KYLL++     + ++   E  F L  + S   
Sbjct: 300 VNNPDSGSATEELSADYSSDPIEIGFNAKYLLDV-----AAQLTGTEAKFMLADAGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           I     ++         A YVLMPMR+
Sbjct: 355 IHDMADET---------ALYVLMPMRV 372


>gi|299133398|ref|ZP_07026593.1| DNA polymerase III, beta subunit [Afipia sp. 1NLS2]
 gi|298593535|gb|EFI53735.1| DNA polymerase III, beta subunit [Afipia sp. 1NLS2]
          Length = 372

 Score =  328 bits (841), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 168/387 (43%), Positives = 246/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+TVER+ +L+ LGH  R++ER+NTIP+  +VL++A++  L +KA+  ++E+T  +PA 
Sbjct: 1   MKVTVERAQLLKSLGHVHRVVERRNTIPILGNVLIRADNARLSLKATDLDLEVTETLPAE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           +   GS TV AH+ YDIVRKL DG+QI    + E    + I  G S F LQ+ PES+FP 
Sbjct: 61  IATGGSTTVPAHMFYDIVRKLPDGSQIVLESDGERAV-LAIRAGRSRFTLQTLPESDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
               E  +SF L+++ +K L++RT FA++TEE RYYLNGI+ H   + ++  L AVATDG
Sbjct: 120 LAAGEMTHSFTLSAADMKRLIDRTQFAISTEETRYYLNGIYLHAAGSGKEQTLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  ++ +      MP +IVPRK VGE+ R++   ++ + + LS+ +I   + ++ ++
Sbjct: 180 HRLAQFDLPLPKSAVGMPGVIVPRKTVGEVQRLIEDNEAEISIELSQGKIRFTLANVVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP +N+KEL V+  +   AVDRVS +SS R +AVKL+LS+ KL ++
Sbjct: 240 SKLIDGTFPDYGRVIPQNNEKELIVDKRDFEAAVDRVSTISSERGRAVKLALSAGKLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V NPD G A E + V Y   P+DI FN +YLL+I   I       D  V +L    S   
Sbjct: 300 VVNPDSGSATEELEVEYASDPLDIGFNSRYLLDIAAQIQG-----DAAVLKLADPGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           ++      K N+D    A YVLMPMR+
Sbjct: 355 VQ-----DKANRD----ALYVLMPMRV 372


>gi|154243960|ref|YP_001414918.1| DNA polymerase III subunit beta [Xanthobacter autotrophicus Py2]
 gi|154158045|gb|ABS65261.1| DNA polymerase III, beta subunit [Xanthobacter autotrophicus Py2]
          Length = 373

 Score =  328 bits (841), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 167/388 (43%), Positives = 242/388 (62%), Gaps = 18/388 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+TVER+++L+ L H  R++ER+NTIP+  +VL++A    LE+KA+  ++E+  ++PA 
Sbjct: 1   MKVTVERAELLKSLSHVHRVVERRNTIPILANVLIKAGKNGLELKATDLDLEVVESVPAE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               G+ TV AH+LYDIVRKL +GAQ+      E GT + +    + F LQ+ PE++FP 
Sbjct: 61  TGQAGATTVPAHVLYDIVRKLPEGAQVQLEAGGERGT-LTVKASRARFSLQTLPEADFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEE---DLKLCAVATD 177
               E+ ++F++  +  + LV++T FA++TEE RYYLNGI+ H+ E       L AVATD
Sbjct: 120 LAAGEFSHTFKVKGADFRRLVDKTQFAISTEETRYYLNGIYLHVTEGAGGKSMLRAVATD 179

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLA AE++  A  A +P +IVPRK V EI ++L  K++   VSLS ++I + + S+ +
Sbjct: 180 GHRLAQAELEAPAGAAGLPGVIVPRKTVAEIQKLLEDKEAEATVSLSTTKIRVQVGSIVL 239

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +LIDG FP+Y  VIP  NDK L V+      AVDRVS +SS R +AVKLSL+  K+ +
Sbjct: 240 TSKLIDGTFPDYGRVIPQGNDKTLIVDKDEFAAAVDRVSTVSSERGRAVKLSLAEGKMTL 299

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           +V NPD G A E + V Y   P+DI FN +YLL+I   +       D    +L    S  
Sbjct: 300 SVTNPDSGSATEELEVDYTAEPLDIGFNSRYLLDITSQLEG-----DTAELKLADPGSPT 354

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            +R    DS      K +A YVLMPMR+
Sbjct: 355 LVR----DS-----TKTDALYVLMPMRV 373


>gi|261215133|ref|ZP_05929414.1| DNA polymerase III subunit beta [Brucella abortus bv. 3 str. Tulya]
 gi|260916740|gb|EEX83601.1| DNA polymerase III subunit beta [Brucella abortus bv. 3 str. Tulya]
          Length = 376

 Score =  327 bits (839), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 172/387 (44%), Positives = 246/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T+ERS++L+ L H  R++ER+NTIP+  +VLLQA    L +KA+  ++E+  A  A 
Sbjct: 5   MRVTLERSNLLKSLNHVYRVVERRNTIPILSNVLLQAEGASLAMKATDLDLEVNEATAAM 64

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DGA++     N  G  +++  G S+F LQ  P+S+FP 
Sbjct: 65  VEQAGATTVPAHLLYDIVRKLPDGAEV-MLSTNPDGGSMSVISGKSSFRLQCLPQSDFPE 123

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
                + +SF + +  LK L++RT FA++TEE RYYLNGIFFH  E D  LKL AVATDG
Sbjct: 124 LTAGAFTHSFRIEAQALKRLIDRTQFAISTEETRYYLNGIFFHAIESDGALKLRAVATDG 183

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AE++  +    MP II+PRK V E+ +++   D  V V LS+++I   + S+ ++
Sbjct: 184 HRLARAELEAPSGTEGMPGIIIPRKTVAELQKLVDVPDVVVTVELSDAKIRFTVGSVVLT 243

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDK+L ++  +   +VDRVS +SS R +AVKLS++  +L +T
Sbjct: 244 SKLIDGTFPDYQRVIPSGNDKKLTIDRQDFAASVDRVSTISSERGRAVKLSIADGQLTLT 303

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A + +   Y+  P+DI FN KYLL+I   +S       + VF L  + S   
Sbjct: 304 VNNPDSGSATDELAADYDGDPLDIGFNSKYLLDITGQLSG-----TDAVFMLADAGSPTL 358

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R       +  D  V   YVLMPMR+
Sbjct: 359 VR-------DTGDEDV--LYVLMPMRV 376


>gi|254694808|ref|ZP_05156636.1| DNA polymerase III subunit beta [Brucella abortus bv. 3 str. Tulya]
          Length = 372

 Score =  327 bits (839), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 172/387 (44%), Positives = 246/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T+ERS++L+ L H  R++ER+NTIP+  +VLLQA    L +KA+  ++E+  A  A 
Sbjct: 1   MRVTLERSNLLKSLNHVYRVVERRNTIPILSNVLLQAEGASLAMKATDLDLEVNEATAAM 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DGA++     N  G  +++  G S+F LQ  P+S+FP 
Sbjct: 61  VEQAGATTVPAHLLYDIVRKLPDGAEV-MLSTNPDGGSMSVISGKSSFRLQCLPQSDFPE 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
                + +SF + +  LK L++RT FA++TEE RYYLNGIFFH  E D  LKL AVATDG
Sbjct: 120 LTAGAFTHSFRIEAQALKRLIDRTQFAISTEETRYYLNGIFFHAIESDGALKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AE++  +    MP II+PRK V E+ +++   D  V V LS+++I   + S+ ++
Sbjct: 180 HRLARAELEAPSGTEGMPGIIIPRKTVAELQKLVDVPDVVVTVELSDAKIRFTVGSVVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDK+L ++  +   +VDRVS +SS R +AVKLS++  +L +T
Sbjct: 240 SKLIDGTFPDYQRVIPSGNDKKLTIDRQDFAASVDRVSTISSERGRAVKLSIADGQLTLT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A + +   Y+  P+DI FN KYLL+I   +S       + VF L  + S   
Sbjct: 300 VNNPDSGSATDELAADYDGDPLDIGFNSKYLLDITGQLSG-----TDAVFMLADAGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R       +  D  V   YVLMPMR+
Sbjct: 355 VR-------DTGDEDV--LYVLMPMRV 372


>gi|256158692|ref|ZP_05456571.1| DNA polymerase III subunit beta [Brucella ceti M490/95/1]
 gi|256254093|ref|ZP_05459629.1| DNA polymerase III subunit beta [Brucella ceti B1/94]
 gi|260169592|ref|ZP_05756403.1| DNA polymerase III subunit beta [Brucella sp. F5/99]
          Length = 372

 Score =  327 bits (839), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 172/387 (44%), Positives = 246/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T+ERS++L+ L H  R++ER+NTIP+  +VLLQA    L +KA+  ++E+  A  A 
Sbjct: 1   MRVTLERSNLLKSLNHVHRVVERRNTIPILSNVLLQAEGASLAMKATDLDLEVNEATAAM 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DGA++     N  G  +++  G S+F LQ  P+S+FP 
Sbjct: 61  VEQAGATTVPAHLLYDIVRKLPDGAEV-MLSTNPDGGSMSVISGKSSFRLQCLPQSDFPE 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
                + +SF + +  LK L++RT FA++TEE RYYLNGIFFH  E D  LKL AVATDG
Sbjct: 120 LTAGAFTHSFRIEAQALKRLIDRTQFAISTEETRYYLNGIFFHTIESDGALKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AE++  +    MP II+PRK V E+ +++   D  V V LS+++I   + S+ ++
Sbjct: 180 HRLARAELEAPSGTEGMPGIIIPRKTVAELQKLVDVPDVVVTVELSDAKIRFTVGSVVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDK+L ++  +   +VDRVS +SS R +AVKLS++  +L +T
Sbjct: 240 SKLIDGTFPDYQRVIPSGNDKKLTIDRQDFAASVDRVSTISSERGRAVKLSIADGQLTLT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A + +   Y+  P+DI FN KYLL+I   +S       + VF L  + S   
Sbjct: 300 VNNPDSGSATDELAADYDGDPLDIGFNSKYLLDITGQLSG-----TDAVFMLADAGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R       +  D  V   YVLMPMR+
Sbjct: 355 VR-------DTGDEDV--LYVLMPMRV 372


>gi|91974484|ref|YP_567143.1| DNA polymerase III subunit beta [Rhodopseudomonas palustris BisB5]
 gi|91680940|gb|ABE37242.1| DNA polymerase III, beta subunit [Rhodopseudomonas palustris BisB5]
          Length = 372

 Score =  327 bits (839), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 174/387 (44%), Positives = 243/387 (62%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+TVER+ +L+ LGH  R++ER+NTIP+  +VL++A +  L +KA+  ++E+   +PA 
Sbjct: 1   MKVTVERAQLLKSLGHVHRVVERRNTIPILGNVLVRAENAQLALKATDLDLEVIETLPAE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               GS TV AH+ YDIVRKL DG+QI    + +    + I  G S F LQ+ PES+FP 
Sbjct: 61  TATAGSTTVPAHMFYDIVRKLPDGSQIVLESDGDRSV-LAIRAGRSRFTLQTLPESDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
               E  +SF LA+S +K L++RT FA++TEE RYYLNGI+ H   + +   L AVATDG
Sbjct: 120 LAAGEMSHSFSLAASDVKRLIDRTQFAISTEETRYYLNGIYLHTAGSAKAATLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  ++   A  + MP +IVPRK VGE+ R++   D+ + + LS  +I   I ++ ++
Sbjct: 180 HRLAQVDLAQPAGASGMPGVIVPRKTVGEVQRLIEDNDAEIAIELSAGKIRFTIGNVVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP +NDKEL V+      AVDRVS +SS R +AVKL+LS+ KL ++
Sbjct: 240 SKLIDGTFPDYGRVIPQNNDKELVVDKKEFEAAVDRVSTISSERGRAVKLALSAGKLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V NPD G A E + V Y    +DI FN +YLL+I   I   EV     V +L    S   
Sbjct: 300 VTNPDSGSATEELEVEYASDALDIGFNSRYLLDIAAQIEG-EV----AVLKLADPGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           I  +D+D+K       NA YVLMPMR+
Sbjct: 355 I--QDRDTK-------NALYVLMPMRV 372


>gi|209883689|ref|YP_002287546.1| DNA polymerase III, beta subunit [Oligotropha carboxidovorans OM5]
 gi|209871885|gb|ACI91681.1| DNA polymerase III, beta subunit [Oligotropha carboxidovorans OM5]
          Length = 372

 Score =  327 bits (839), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 168/387 (43%), Positives = 245/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+TVER+ +L+ LGH  R++ER+NTIP+  +VL++A +  L +KA+  ++E+T  +PA 
Sbjct: 1   MKVTVERAQLLKSLGHVHRVVERRNTIPILGNVLIRAENAKLSLKATDLDLEVTETLPAE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           +   GS TV AH+ YDIVRKL DG+QI    + E    + I  G S F LQ+ PES+FP 
Sbjct: 61  IATGGSTTVPAHMFYDIVRKLPDGSQIVLESDGERAV-LAIRAGRSRFTLQTLPESDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
               E  +SF L ++ +K L++RT FA++TEE RYYLNGI+ H   +  +  L AVATDG
Sbjct: 120 LAAGEMTHSFTLTAADVKRLIDRTQFAISTEETRYYLNGIYLHAAGSAAEQTLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  ++ +    A MP +IVPRK VGE+ R++   ++ + + LS+++I   + ++ ++
Sbjct: 180 HRLAQFDLPLPKSAAGMPGVIVPRKTVGEVQRLIEDTEAEIAIELSQAKIRFTLANVVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP +N+KEL V+  +   AVDRVS +SS R +AVKL+LS+ KL ++
Sbjct: 240 SKLIDGTFPDYGRVIPQNNEKELVVDKRDFEAAVDRVSTISSERGRAVKLALSAGKLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V NPD G A E + V Y   P+DI FN +YLL+I   I       +  V +L    S   
Sbjct: 300 VVNPDSGSATEELEVEYASDPLDIGFNSRYLLDIAAQIQG-----EAAVLKLADPGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           ++      K N+D    A YVLMPMR+
Sbjct: 355 VQ-----DKANRD----ALYVLMPMRV 372


>gi|188579289|ref|YP_001922734.1| DNA polymerase III subunit beta [Methylobacterium populi BJ001]
 gi|179342787|gb|ACB78199.1| DNA polymerase III, beta subunit [Methylobacterium populi BJ001]
          Length = 373

 Score =  327 bits (839), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 173/388 (44%), Positives = 239/388 (61%), Gaps = 18/388 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++TVER+ +L  LGH  R++ER+NTIP+  +VLL+  D  L++KA+  +IE+T  + A 
Sbjct: 1   MRVTVERAALLRSLGHVHRVVERRNTIPILSNVLLRTGDNGLQLKATDLDIEVTETVAAD 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V   G+ TV AH++YDIVRKL +GAQ+S     E G ++ I  G S F L + PE +FP 
Sbjct: 61  VLDAGATTVPAHVIYDIVRKLPEGAQVSLETSGETG-QMTIRSGRSRFALGALPEGDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
               E  +SF + +S LK L+E+T FA++TEE RYYLNGI+FH  E +  LKL AVATDG
Sbjct: 120 LAAGELPHSFSIPASELKQLIEKTQFAISTEETRYYLNGIYFHTVEVEGALKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIE-SLSM 237
           HRLA  E +       MP IIVPRKAV EI +++     SV+V LS ++I L     +++
Sbjct: 180 HRLARVETEAPEDSRGMPGIIVPRKAVAEIQKLVDDGGESVQVELSPAKIRLTFAGGVTL 239

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
             +LIDG FP+YQ VIP  NDK L V      +AVDRVS +SS R +AVKL+++  +L +
Sbjct: 240 ISKLIDGTFPDYQRVIPTGNDKRLTVERDAFAKAVDRVSTISSERGRAVKLAVAEGRLAL 299

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           +V NPD G A E ++V Y    +DI FN +YLL+I   +       D  +F+L    S  
Sbjct: 300 SVTNPDAGSATEELDVDYEASALDIGFNARYLLDITAQLQG-----DTALFKLADPGSPT 354

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            I+ +D            A YVLMPMR+
Sbjct: 355 LIQDRD---------GAPALYVLMPMRV 373


>gi|261221233|ref|ZP_05935514.1| DNA polymerase III subunit beta [Brucella ceti B1/94]
 gi|261759118|ref|ZP_06002827.1| DNA polymerase subunit III [Brucella sp. F5/99]
 gi|265997194|ref|ZP_06109751.1| DNA polymerase III subunit beta [Brucella ceti M490/95/1]
 gi|260919817|gb|EEX86470.1| DNA polymerase III subunit beta [Brucella ceti B1/94]
 gi|261739102|gb|EEY27098.1| DNA polymerase subunit III [Brucella sp. F5/99]
 gi|262551662|gb|EEZ07652.1| DNA polymerase III subunit beta [Brucella ceti M490/95/1]
          Length = 376

 Score =  327 bits (839), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 172/387 (44%), Positives = 246/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T+ERS++L+ L H  R++ER+NTIP+  +VLLQA    L +KA+  ++E+  A  A 
Sbjct: 5   MRVTLERSNLLKSLNHVHRVVERRNTIPILSNVLLQAEGASLAMKATDLDLEVNEATAAM 64

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DGA++     N  G  +++  G S+F LQ  P+S+FP 
Sbjct: 65  VEQAGATTVPAHLLYDIVRKLPDGAEV-MLSTNPDGGSMSVISGKSSFRLQCLPQSDFPE 123

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
                + +SF + +  LK L++RT FA++TEE RYYLNGIFFH  E D  LKL AVATDG
Sbjct: 124 LTAGAFTHSFRIEAQALKRLIDRTQFAISTEETRYYLNGIFFHTIESDGALKLRAVATDG 183

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AE++  +    MP II+PRK V E+ +++   D  V V LS+++I   + S+ ++
Sbjct: 184 HRLARAELEAPSGTEGMPGIIIPRKTVAELQKLVDVPDVVVTVELSDAKIRFTVGSVVLT 243

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDK+L ++  +   +VDRVS +SS R +AVKLS++  +L +T
Sbjct: 244 SKLIDGTFPDYQRVIPSGNDKKLTIDRQDFAASVDRVSTISSERGRAVKLSIADGQLTLT 303

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A + +   Y+  P+DI FN KYLL+I   +S       + VF L  + S   
Sbjct: 304 VNNPDSGSATDELAADYDGDPLDIGFNSKYLLDITGQLSG-----TDAVFMLADAGSPTL 358

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R       +  D  V   YVLMPMR+
Sbjct: 359 VR-------DTGDEDV--LYVLMPMRV 376


>gi|189023270|ref|YP_001934038.1| DNA polymerase III subunit beta [Brucella abortus S19]
 gi|254696436|ref|ZP_05158264.1| DNA polymerase III subunit beta [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254731348|ref|ZP_05189926.1| DNA polymerase III subunit beta [Brucella abortus bv. 4 str. 292]
 gi|189018842|gb|ACD71564.1| DNA polymerase III, beta chain [Brucella abortus S19]
          Length = 372

 Score =  327 bits (838), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 172/387 (44%), Positives = 246/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T+ERS++L+ L H  R++ER+NTIP+  +VLLQA    L +KA+  ++E+  A  A 
Sbjct: 1   MRVTLERSNLLKSLNHVHRVVERRNTIPILSNVLLQAEGASLAMKATDLDLEVNEATAAM 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DGA++     N  G  +++  G S+F LQ  P+S+FP 
Sbjct: 61  VEQAGATTVPAHLLYDIVRKLPDGAEV-MLSTNPDGGSMSVISGKSSFRLQCLPQSDFPE 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
                + +SF + +  LK L++RT FA++TEE RYYLNGIFFH  E D  LKL AVATDG
Sbjct: 120 LTAGAFTHSFRIEAQALKRLIDRTQFAISTEETRYYLNGIFFHAIESDGALKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AE++  +    MP II+PRK V E+ +++   D  V V LS+++I   + S+ ++
Sbjct: 180 HRLARAELEAPSGTEGMPGIIIPRKTVAELQKLVDVPDVVVTVELSDTKIRFTVGSVVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDK+L ++  +   +VDRVS +SS R +AVKLS++  +L +T
Sbjct: 240 SKLIDGTFPDYQRVIPSGNDKKLTIDRQDFAASVDRVSTISSERGRAVKLSIADGQLTLT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A + +   Y+  P+DI FN KYLL+I   +S       + VF L  + S   
Sbjct: 300 VNNPDSGSATDELAADYDGDPLDIGFNSKYLLDITGQLSG-----TDAVFMLADAGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R       +  D  V   YVLMPMR+
Sbjct: 355 VR-------DTGDEDV--LYVLMPMRV 372


>gi|260563085|ref|ZP_05833571.1| DNA polymerase subunit III [Brucella melitensis bv. 1 str. 16M]
 gi|261218004|ref|ZP_05932285.1| DNA polymerase III subunit beta [Brucella ceti M13/05/1]
 gi|261314778|ref|ZP_05953975.1| DNA polymerase III subunit beta [Brucella pinnipedialis M163/99/10]
 gi|261316661|ref|ZP_05955858.1| DNA polymerase III subunit beta [Brucella pinnipedialis B2/94]
 gi|261321146|ref|ZP_05960343.1| DNA polymerase III subunit beta [Brucella ceti M644/93/1]
 gi|261324124|ref|ZP_05963321.1| DNA polymerase III subunit beta [Brucella neotomae 5K33]
 gi|261751326|ref|ZP_05995035.1| DNA polymerase III subunit beta [Brucella suis bv. 5 str. 513]
 gi|261755891|ref|ZP_05999600.1| DNA polymerase III subunit beta [Brucella suis bv. 3 str. 686]
 gi|265987733|ref|ZP_06100290.1| DNA polymerase III subunit beta [Brucella pinnipedialis M292/94/1]
 gi|265992207|ref|ZP_06104764.1| DNA polymerase III subunit beta [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265993947|ref|ZP_06106504.1| DNA polymerase III subunit beta [Brucella melitensis bv. 3 str.
           Ether]
 gi|265999708|ref|ZP_05467475.2| DNA polymerase subunit III [Brucella melitensis bv. 2 str. 63/9]
 gi|260153101|gb|EEW88193.1| DNA polymerase subunit III [Brucella melitensis bv. 1 str. 16M]
 gi|260923093|gb|EEX89661.1| DNA polymerase III subunit beta [Brucella ceti M13/05/1]
 gi|261293836|gb|EEX97332.1| DNA polymerase III subunit beta [Brucella ceti M644/93/1]
 gi|261295884|gb|EEX99380.1| DNA polymerase III subunit beta [Brucella pinnipedialis B2/94]
 gi|261300104|gb|EEY03601.1| DNA polymerase III subunit beta [Brucella neotomae 5K33]
 gi|261303804|gb|EEY07301.1| DNA polymerase III subunit beta [Brucella pinnipedialis M163/99/10]
 gi|261741079|gb|EEY29005.1| DNA polymerase III subunit beta [Brucella suis bv. 5 str. 513]
 gi|261745644|gb|EEY33570.1| DNA polymerase III subunit beta [Brucella suis bv. 3 str. 686]
 gi|262764928|gb|EEZ10849.1| DNA polymerase III subunit beta [Brucella melitensis bv. 3 str.
           Ether]
 gi|263003273|gb|EEZ15566.1| DNA polymerase III subunit beta [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263095428|gb|EEZ19029.1| DNA polymerase subunit III [Brucella melitensis bv. 2 str. 63/9]
 gi|264659930|gb|EEZ30191.1| DNA polymerase III subunit beta [Brucella pinnipedialis M292/94/1]
 gi|326537731|gb|ADZ85946.1| DNA polymerase III, beta subunit [Brucella melitensis M5-90]
          Length = 376

 Score =  327 bits (838), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 172/387 (44%), Positives = 246/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T+ERS++L+ L H  R++ER+NTIP+  +VLLQA    L +KA+  ++E+  A  A 
Sbjct: 5   MRVTLERSNLLKSLNHVHRVVERRNTIPILSNVLLQAEGASLAMKATDLDLEVNEATAAM 64

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DGA++     N  G  +++  G S+F LQ  P+S+FP 
Sbjct: 65  VEQAGATTVPAHLLYDIVRKLPDGAEV-MLSTNPDGGSMSVISGKSSFRLQCLPQSDFPE 123

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
                + +SF + +  LK L++RT FA++TEE RYYLNGIFFH  E D  LKL AVATDG
Sbjct: 124 LTAGAFTHSFRIEAQALKRLIDRTQFAISTEETRYYLNGIFFHAIESDGALKLRAVATDG 183

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AE++  +    MP II+PRK V E+ +++   D  V V LS+++I   + S+ ++
Sbjct: 184 HRLARAELEAPSGTEGMPGIIIPRKTVAELQKLVDVPDVVVTVELSDAKIRFTVGSVVLT 243

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDK+L ++  +   +VDRVS +SS R +AVKLS++  +L +T
Sbjct: 244 SKLIDGTFPDYQRVIPSGNDKKLTIDRQDFAASVDRVSTISSERGRAVKLSIADGQLTLT 303

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A + +   Y+  P+DI FN KYLL+I   +S       + VF L  + S   
Sbjct: 304 VNNPDSGSATDELAADYDGDPLDIGFNSKYLLDITGQLSG-----TDAVFMLADAGSPTL 358

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R       +  D  V   YVLMPMR+
Sbjct: 359 VR-------DTGDEDV--LYVLMPMRV 376


>gi|328541626|ref|YP_004301735.1| DNA polymerase III, beta subunit [polymorphum gilvum SL003B-26A1]
 gi|326411378|gb|ADZ68441.1| DNA polymerase III, beta subunit [Polymorphum gilvum SL003B-26A1]
          Length = 372

 Score =  327 bits (838), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 166/388 (42%), Positives = 245/388 (63%), Gaps = 19/388 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ER+D+L+ L H  R++ER+NTIP+  +VLL+A  G L++KA+  ++E+   +PA 
Sbjct: 1   MKATLERTDLLKSLTHVHRVVERRNTIPILSNVLLRAEHGALKLKATDLDLEVLETVPAM 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           ++  G  TV AH++YDIVRKL +G+Q+      +  T + I  G S F LQ  PE++FP 
Sbjct: 61  IEAPGGTTVPAHMIYDIVRKLPEGSQVVLETTGDNAT-LEIRAGRSRFALQMLPEADFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
                + + F L++  ++ L++ T FA++TEE RYYLNGI+ H     +  K  AVATDG
Sbjct: 120 LTAGTFSHQFTLSAGAIRKLIDTTQFAISTEETRYYLNGIYLHTVDTPQGQKFRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AEV   A  A MP IIVPRK VGEI ++L  +++ V+V +S+++I +    + ++
Sbjct: 180 HRLAQAEVPAPAGAAGMPGIIVPRKTVGEIQKLLEDREAEVQVEISDTKIRVTTGPVVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP  NDKELRV+    R+AVDRVS +SS R +AVKL+LS  +L + 
Sbjct: 240 SKLIDGTFPDYGRVIPQHNDKELRVDRDEFREAVDRVSTISSERGRAVKLALSEGRLVLA 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A E + V Y+  P++I FN +YLL+I     + ++  D  +FRL    S   
Sbjct: 300 VNNPDSGSATEELAVEYDSDPLEIGFNSRYLLDI-----AAQLTGDTALFRLADPGSPTL 354

Query: 359 IRGKDKDSKNNKDNKV-NAFYVLMPMRI 385
           +          +DN   +  +VLMPMR+
Sbjct: 355 V----------QDNAAEDCLFVLMPMRV 372


>gi|260546287|ref|ZP_05822027.1| DNA polymerase subunit III [Brucella abortus NCTC 8038]
 gi|260759081|ref|ZP_05871429.1| DNA polymerase III subunit beta [Brucella abortus bv. 4 str. 292]
 gi|260760807|ref|ZP_05873150.1| DNA polymerase III subunit beta [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260096394|gb|EEW80270.1| DNA polymerase subunit III [Brucella abortus NCTC 8038]
 gi|260669399|gb|EEX56339.1| DNA polymerase III subunit beta [Brucella abortus bv. 4 str. 292]
 gi|260671239|gb|EEX58060.1| DNA polymerase III subunit beta [Brucella abortus bv. 2 str.
           86/8/59]
          Length = 376

 Score =  327 bits (838), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 172/387 (44%), Positives = 246/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T+ERS++L+ L H  R++ER+NTIP+  +VLLQA    L +KA+  ++E+  A  A 
Sbjct: 5   MRVTLERSNLLKSLNHVHRVVERRNTIPILSNVLLQAEGASLAMKATDLDLEVNEATAAM 64

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DGA++     N  G  +++  G S+F LQ  P+S+FP 
Sbjct: 65  VEQAGATTVPAHLLYDIVRKLPDGAEV-MLSTNPDGGSMSVISGKSSFRLQCLPQSDFPE 123

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
                + +SF + +  LK L++RT FA++TEE RYYLNGIFFH  E D  LKL AVATDG
Sbjct: 124 LTAGAFTHSFRIEAQALKRLIDRTQFAISTEETRYYLNGIFFHAIESDGALKLRAVATDG 183

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AE++  +    MP II+PRK V E+ +++   D  V V LS+++I   + S+ ++
Sbjct: 184 HRLARAELEAPSGTEGMPGIIIPRKTVAELQKLVDVPDVVVTVELSDTKIRFTVGSVVLT 243

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDK+L ++  +   +VDRVS +SS R +AVKLS++  +L +T
Sbjct: 244 SKLIDGTFPDYQRVIPSGNDKKLTIDRQDFAASVDRVSTISSERGRAVKLSIADGQLTLT 303

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A + +   Y+  P+DI FN KYLL+I   +S       + VF L  + S   
Sbjct: 304 VNNPDSGSATDELAADYDGDPLDIGFNSKYLLDITGQLSG-----TDAVFMLADAGSPTL 358

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R       +  D  V   YVLMPMR+
Sbjct: 359 VR-------DTGDEDV--LYVLMPMRV 376


>gi|254700820|ref|ZP_05162648.1| DNA polymerase III subunit beta [Brucella suis bv. 5 str. 513]
 gi|254705187|ref|ZP_05167015.1| DNA polymerase III subunit beta [Brucella suis bv. 3 str. 686]
 gi|254707297|ref|ZP_05169125.1| DNA polymerase III subunit beta [Brucella pinnipedialis M163/99/10]
 gi|254709164|ref|ZP_05170975.1| DNA polymerase III subunit beta [Brucella pinnipedialis B2/94]
 gi|254713412|ref|ZP_05175223.1| DNA polymerase III subunit beta [Brucella ceti M644/93/1]
 gi|254716231|ref|ZP_05178042.1| DNA polymerase III subunit beta [Brucella ceti M13/05/1]
 gi|256030688|ref|ZP_05444302.1| DNA polymerase III subunit beta [Brucella pinnipedialis M292/94/1]
 gi|256045792|ref|ZP_05448670.1| DNA polymerase III subunit beta [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256060147|ref|ZP_05450329.1| DNA polymerase III subunit beta [Brucella neotomae 5K33]
 gi|256112511|ref|ZP_05453432.1| DNA polymerase III subunit beta [Brucella melitensis bv. 3 str.
           Ether]
 gi|326408013|gb|ADZ65078.1| DNA polymerase III, beta chain [Brucella melitensis M28]
          Length = 372

 Score =  327 bits (838), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 172/387 (44%), Positives = 246/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T+ERS++L+ L H  R++ER+NTIP+  +VLLQA    L +KA+  ++E+  A  A 
Sbjct: 1   MRVTLERSNLLKSLNHVHRVVERRNTIPILSNVLLQAEGASLAMKATDLDLEVNEATAAM 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DGA++     N  G  +++  G S+F LQ  P+S+FP 
Sbjct: 61  VEQAGATTVPAHLLYDIVRKLPDGAEV-MLSTNPDGGSMSVISGKSSFRLQCLPQSDFPE 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
                + +SF + +  LK L++RT FA++TEE RYYLNGIFFH  E D  LKL AVATDG
Sbjct: 120 LTAGAFTHSFRIEAQALKRLIDRTQFAISTEETRYYLNGIFFHAIESDGALKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AE++  +    MP II+PRK V E+ +++   D  V V LS+++I   + S+ ++
Sbjct: 180 HRLARAELEAPSGTEGMPGIIIPRKTVAELQKLVDVPDVVVTVELSDAKIRFTVGSVVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDK+L ++  +   +VDRVS +SS R +AVKLS++  +L +T
Sbjct: 240 SKLIDGTFPDYQRVIPSGNDKKLTIDRQDFAASVDRVSTISSERGRAVKLSIADGQLTLT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A + +   Y+  P+DI FN KYLL+I   +S       + VF L  + S   
Sbjct: 300 VNNPDSGSATDELAADYDGDPLDIGFNSKYLLDITGQLSG-----TDAVFMLADAGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R       +  D  V   YVLMPMR+
Sbjct: 355 VR-------DTGDEDV--LYVLMPMRV 372


>gi|13474647|ref|NP_106216.1| DNA polymerase III subunit beta [Mesorhizobium loti MAFF303099]
 gi|260461962|ref|ZP_05810207.1| DNA polymerase III, beta subunit [Mesorhizobium opportunistum
           WSM2075]
 gi|14025402|dbj|BAB52002.1| DNA polymerase III beta subunit [Mesorhizobium loti MAFF303099]
 gi|259032209|gb|EEW33475.1| DNA polymerase III, beta subunit [Mesorhizobium opportunistum
           WSM2075]
          Length = 372

 Score =  327 bits (838), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 170/387 (43%), Positives = 245/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++ +ERS++L+ L H  R++ER+NTIP+  +VLL A    LE+KA+  ++E+T A PA 
Sbjct: 1   MRVILERSNLLKSLNHVHRVVERRNTIPILSNVLLSAEGASLEMKATDLDLEVTEATPAK 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DGA++   K +E G  + ++ G S+F LQ  P+S+FP 
Sbjct: 61  VERGGATTVPAHLLYDIVRKLSDGAEV-MLKTDEDGNAMTVTSGRSSFRLQCLPQSDFPE 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINE--EDLKLCAVATDG 178
                + + F L S  LK L+E+T FA++TEE RYYLNGI+ H +E    LKL +VATDG
Sbjct: 120 LSAGSFSHIFRLDSVALKGLIEKTQFAISTEETRYYLNGIYLHTHEVGGKLKLRSVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AE+D  A    MP II+PRK V E+ +++   D +V   LS+++I   I S+ ++
Sbjct: 180 HRLARAEIDAPAGSEGMPGIIIPRKTVSELQKLVDDPDVAVTTELSDTKIRFTIGSVVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDK+L ++  +   AVDRVS +SS R +AVKLS+S  ++ + 
Sbjct: 240 SKLIDGTFPDYQRVIPTGNDKKLILDRQSFAAAVDRVSTISSERGRAVKLSISEGQVTLA 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A E +   Y+  P++I FN KYLL++     + ++   E  F L  + S   
Sbjct: 300 VNNPDSGSATEELAADYSSDPIEIGFNAKYLLDV-----AAQLTGTEAKFMLADAGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           I     ++         A YVLMPMR+
Sbjct: 355 IHDMADET---------ALYVLMPMRV 372


>gi|146337177|ref|YP_001202225.1| DNA polymerase III subunit beta [Bradyrhizobium sp. ORS278]
 gi|146189983|emb|CAL73975.1| DNA polymerase III, beta-subunit [Bradyrhizobium sp. ORS278]
          Length = 372

 Score =  327 bits (838), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 171/387 (44%), Positives = 244/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+TVER+ +L+ LGH  R++ER+NTIP+  +VL++A +  L ++A+  ++E+T  + A 
Sbjct: 1   MKVTVERAQLLKSLGHVHRVVERRNTIPILGNVLVRAENARLSLRATDLDLEVTETLAAE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               GS TV AH+ YDIVRKL DG+QI    + E    + I  G S F LQ+ PES+FP 
Sbjct: 61  TATAGSTTVPAHMFYDIVRKLPDGSQIVLESDGERAV-LAIRAGRSKFTLQTLPESDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHIN--EEDLKLCAVATDG 178
               E  ++F + +  +K+L++RT FA++TEE RYYLNGI+ H     +   L AVATDG
Sbjct: 120 LAAGEMTHAFGVPAKDIKSLIDRTQFAISTEETRYYLNGIYLHAGGTAKQPTLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  ++   +  A+MP +IVPRK VGE+ R++   DS +K+ LS+ +I   +  + ++
Sbjct: 180 HRLAQVDLPQPSGAAEMPGVIVPRKTVGEVQRLIEDNDSEIKIELSQGKIRFTLGQVVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP +NDKEL V+  +   AVDRVS +SS R +AVKL+LS+ KL ++
Sbjct: 240 SKLIDGTFPDYGRVIPQNNDKELVVDKADFAAAVDRVSTISSERGRAVKLALSAGKLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V NPD G A E + V Y    +DI FN +YLL+I   I   EV     V RL    S   
Sbjct: 300 VTNPDSGSATEELEVEYASDALDIGFNSRYLLDIAAQIEG-EV----AVLRLADPGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           I+        ++DN+ NA YVLMPMR+
Sbjct: 355 IQ--------DRDNR-NALYVLMPMRV 372


>gi|254718226|ref|ZP_05180037.1| DNA polymerase III subunit beta [Brucella sp. 83/13]
 gi|306839966|ref|ZP_07472760.1| DNA polymerase III, beta subunit [Brucella sp. NF 2653]
 gi|306404930|gb|EFM61215.1| DNA polymerase III, beta subunit [Brucella sp. NF 2653]
          Length = 372

 Score =  327 bits (838), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 172/387 (44%), Positives = 246/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T+ERS++L+ L H  R++ER+NTIP+  +VLLQA    L +KA+  ++E+  A  A 
Sbjct: 1   MRVTLERSNLLKSLNHVHRVVERRNTIPILSNVLLQAEGASLAMKATDLDLEVNEATAAM 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DGA++     N  G  +++  G S+F LQ  P+S+FP 
Sbjct: 61  VEQAGATTVPAHLLYDIVRKLPDGAEV-MLSTNPDGGSMSVISGKSSFRLQCLPQSDFPE 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
                + +SF + +  LK L++RT FA++TEE RYYLNGIFFH  E D  LKL AVATDG
Sbjct: 120 LTAGAFTHSFRIDAQALKRLIDRTQFAISTEETRYYLNGIFFHAIESDGALKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AE++  +    MP II+PRK V E+ +++   D  V V LS+++I   + S+ ++
Sbjct: 180 HRLARAELEAPSGTEGMPGIIIPRKTVAELQKLVDVPDVVVTVELSDAKIRFTVGSVVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDK+L ++  +   +VDRVS +SS R +AVKLS++  +L +T
Sbjct: 240 SKLIDGTFPDYQRVIPSGNDKKLTIDRQDFAASVDRVSTISSERGRAVKLSIADGQLTLT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A + +   Y+  P+DI FN KYLL+I   +S       + VF L  + S   
Sbjct: 300 VNNPDSGSATDELAADYDGDPLDIGFNSKYLLDITGQLSG-----TDAVFMLADAGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R       +  D  V   YVLMPMR+
Sbjct: 355 VR-------DTGDEDV--LYVLMPMRV 372


>gi|260567347|ref|ZP_05837817.1| DNA polymerase subunit III [Brucella suis bv. 4 str. 40]
 gi|260156865|gb|EEW91945.1| DNA polymerase subunit III [Brucella suis bv. 4 str. 40]
          Length = 376

 Score =  327 bits (837), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 171/387 (44%), Positives = 246/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T+ERS++L+ L H  R++ER+NTIP+  +VLLQA    L +KA+  ++E+  A  A 
Sbjct: 5   MRVTLERSNLLKSLNHVHRVVERRNTIPILSNVLLQAEGASLAMKATDLDLEVNEATAAM 64

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDI+RKL DGA++     N  G  +++  G S+F LQ  P+S+FP 
Sbjct: 65  VEQAGATTVPAHLLYDIIRKLPDGAEV-MLSTNPDGGSMSVISGKSSFRLQCLPQSDFPE 123

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
                + +SF + +  LK L++RT FA++TEE RYYLNGIFFH  E D  LKL AVATDG
Sbjct: 124 LTAGAFTHSFRIEAQALKRLIDRTQFAISTEETRYYLNGIFFHAIESDGALKLRAVATDG 183

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AE++  +    MP II+PRK V E+ +++   D  V V LS+++I   + S+ ++
Sbjct: 184 HRLARAELEAPSGTEGMPGIIIPRKTVAELQKLVDVPDVVVTVELSDAKIRFTVGSVVLT 243

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDK+L ++  +   +VDRVS +SS R +AVKLS++  +L +T
Sbjct: 244 SKLIDGTFPDYQRVIPSGNDKKLTIDRQDFAASVDRVSTISSERGRAVKLSIADGQLTLT 303

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A + +   Y+  P+DI FN KYLL+I   +S       + VF L  + S   
Sbjct: 304 VNNPDSGSATDELAADYDGDPLDIGFNSKYLLDITGQLSG-----TDAVFMLADAGSPTL 358

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R       +  D  V   YVLMPMR+
Sbjct: 359 VR-------DTGDEDV--LYVLMPMRV 376


>gi|265983182|ref|ZP_06095917.1| DNA polymerase III subunit beta [Brucella sp. 83/13]
 gi|264661774|gb|EEZ32035.1| DNA polymerase III subunit beta [Brucella sp. 83/13]
          Length = 376

 Score =  327 bits (837), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 172/387 (44%), Positives = 246/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T+ERS++L+ L H  R++ER+NTIP+  +VLLQA    L +KA+  ++E+  A  A 
Sbjct: 5   MRVTLERSNLLKSLNHVHRVVERRNTIPILSNVLLQAEGASLAMKATDLDLEVNEATAAM 64

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DGA++     N  G  +++  G S+F LQ  P+S+FP 
Sbjct: 65  VEQAGATTVPAHLLYDIVRKLPDGAEV-MLSTNPDGGSMSVISGKSSFRLQCLPQSDFPE 123

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
                + +SF + +  LK L++RT FA++TEE RYYLNGIFFH  E D  LKL AVATDG
Sbjct: 124 LTAGAFTHSFRIDAQALKRLIDRTQFAISTEETRYYLNGIFFHAIESDGALKLRAVATDG 183

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AE++  +    MP II+PRK V E+ +++   D  V V LS+++I   + S+ ++
Sbjct: 184 HRLARAELEAPSGTEGMPGIIIPRKTVAELQKLVDVPDVVVTVELSDAKIRFTVGSVVLT 243

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDK+L ++  +   +VDRVS +SS R +AVKLS++  +L +T
Sbjct: 244 SKLIDGTFPDYQRVIPSGNDKKLTIDRQDFAASVDRVSTISSERGRAVKLSIADGQLTLT 303

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A + +   Y+  P+DI FN KYLL+I   +S       + VF L  + S   
Sbjct: 304 VNNPDSGSATDELAADYDGDPLDIGFNSKYLLDITGQLSG-----TDAVFMLADAGSPTL 358

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R       +  D  V   YVLMPMR+
Sbjct: 359 VR-------DTGDEDV--LYVLMPMRV 376


>gi|225626553|ref|ZP_03784592.1| DNA polymerase III, beta subunit [Brucella ceti str. Cudo]
 gi|225618210|gb|EEH15253.1| DNA polymerase III, beta subunit [Brucella ceti str. Cudo]
          Length = 397

 Score =  327 bits (837), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 172/387 (44%), Positives = 246/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T+ERS++L+ L H  R++ER+NTIP+  +VLLQA    L +KA+  ++E+  A  A 
Sbjct: 26  MRVTLERSNLLKSLNHVHRVVERRNTIPILSNVLLQAEGASLAMKATDLDLEVNEATAAM 85

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DGA++     N  G  +++  G S+F LQ  P+S+FP 
Sbjct: 86  VEQAGATTVPAHLLYDIVRKLPDGAEV-MLSTNPDGGSMSVISGKSSFRLQCLPQSDFPE 144

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
                + +SF + +  LK L++RT FA++TEE RYYLNGIFFH  E D  LKL AVATDG
Sbjct: 145 LTAGAFTHSFRIEAQALKRLIDRTQFAISTEETRYYLNGIFFHTIESDGALKLRAVATDG 204

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AE++  +    MP II+PRK V E+ +++   D  V V LS+++I   + S+ ++
Sbjct: 205 HRLARAELEAPSGTEGMPGIIIPRKTVAELQKLVDVPDVVVTVELSDAKIRFTVGSVVLT 264

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDK+L ++  +   +VDRVS +SS R +AVKLS++  +L +T
Sbjct: 265 SKLIDGTFPDYQRVIPSGNDKKLTIDRQDFAASVDRVSTISSERGRAVKLSIADGQLTLT 324

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A + +   Y+  P+DI FN KYLL+I   +S       + VF L  + S   
Sbjct: 325 VNNPDSGSATDELAADYDGDPLDIGFNSKYLLDITGQLSG-----TDAVFMLADAGSPTL 379

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R       +  D  V   YVLMPMR+
Sbjct: 380 VR-------DTGDEDV--LYVLMPMRV 397


>gi|170738369|ref|YP_001767024.1| DNA polymerase III subunit beta [Methylobacterium sp. 4-46]
 gi|168192643|gb|ACA14590.1| DNA polymerase III, beta subunit [Methylobacterium sp. 4-46]
          Length = 373

 Score =  327 bits (837), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 171/388 (44%), Positives = 240/388 (61%), Gaps = 18/388 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++TVER+ +L  LGH  R++ER+NTIP+  +VLL+++   L+++A+  +IE+T  IPA 
Sbjct: 1   MRVTVERAALLRSLGHVHRVVERRNTIPILSNVLLRSSADGLQLRATDLDIEVTETIPAD 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V   G+ TV AH++YDIVRKL DG Q+S     E G ++ I  G S F L + PE++FP 
Sbjct: 61  VVDGGATTVPAHVIYDIVRKLPDGVQVSLETTGETG-QMQIRSGRSRFMLGALPEADFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
               E  + F+L ++ LK L+++T FA++TEE RYYLNGIFFH    E  L+L AVATDG
Sbjct: 120 LAAGELPHRFQLQAAELKKLIDKTQFAISTEETRYYLNGIFFHTIETEAGLRLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIES-LSM 237
           HRLA  E+        MP IIVPRKAV EI +++     SV V LS +++     S +++
Sbjct: 180 HRLARVEMPAPEGSRGMPGIIVPRKAVAEIQKLVEDGGDSVGVELSPAKVRFTFSSGVTL 239

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
             +LIDG FP+YQ VIP  NDK L V      +AVDRVS +SS R +AVKL++   +L +
Sbjct: 240 ISKLIDGTFPDYQRVIPTGNDKLLTVEREQFAKAVDRVSTISSERGRAVKLAVGGGRLSL 299

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           +V+NPD G A E ++V Y   P+DI FN +YLL+I   +       D  +F+L    S  
Sbjct: 300 SVNNPDSGSATEELDVDYEAAPLDIGFNARYLLDITAQLDG-----DSALFKLADPGSPT 354

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            I+ K+            A YVLMPMR+
Sbjct: 355 LIQDKE---------GAPALYVLMPMRV 373


>gi|62288993|ref|YP_220786.1| DNA polymerase III subunit beta [Brucella abortus bv. 1 str. 9-941]
 gi|82698934|ref|YP_413508.1| DNA polymerase III subunit beta [Brucella melitensis biovar Abortus
           2308]
 gi|237814483|ref|ZP_04593481.1| DNA polymerase III, beta subunit [Brucella abortus str. 2308 A]
 gi|62195125|gb|AAX73425.1| DnaN, DNA polymerase III, beta subunit [Brucella abortus bv. 1 str.
           9-941]
 gi|82615035|emb|CAJ09958.1| DNA polymerase III, beta chain:Inorganic pyrophosphatase [Brucella
           melitensis biovar Abortus 2308]
 gi|237789320|gb|EEP63530.1| DNA polymerase III, beta subunit [Brucella abortus str. 2308 A]
          Length = 397

 Score =  327 bits (837), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 172/387 (44%), Positives = 246/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T+ERS++L+ L H  R++ER+NTIP+  +VLLQA    L +KA+  ++E+  A  A 
Sbjct: 26  MRVTLERSNLLKSLNHVHRVVERRNTIPILSNVLLQAEGASLAMKATDLDLEVNEATAAM 85

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DGA++     N  G  +++  G S+F LQ  P+S+FP 
Sbjct: 86  VEQAGATTVPAHLLYDIVRKLPDGAEV-MLSTNPDGGSMSVISGKSSFRLQCLPQSDFPE 144

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
                + +SF + +  LK L++RT FA++TEE RYYLNGIFFH  E D  LKL AVATDG
Sbjct: 145 LTAGAFTHSFRIEAQALKRLIDRTQFAISTEETRYYLNGIFFHAIESDGALKLRAVATDG 204

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AE++  +    MP II+PRK V E+ +++   D  V V LS+++I   + S+ ++
Sbjct: 205 HRLARAELEAPSGTEGMPGIIIPRKTVAELQKLVDVPDVVVTVELSDTKIRFTVGSVVLT 264

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDK+L ++  +   +VDRVS +SS R +AVKLS++  +L +T
Sbjct: 265 SKLIDGTFPDYQRVIPSGNDKKLTIDRQDFAASVDRVSTISSERGRAVKLSIADGQLTLT 324

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A + +   Y+  P+DI FN KYLL+I   +S       + VF L  + S   
Sbjct: 325 VNNPDSGSATDELAADYDGDPLDIGFNSKYLLDITGQLSG-----TDAVFMLADAGSPTL 379

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R       +  D  V   YVLMPMR+
Sbjct: 380 VR-------DTGDEDV--LYVLMPMRV 397


>gi|17988225|ref|NP_540859.1| DNA polymerase III subunit beta [Brucella melitensis bv. 1 str.
           16M]
 gi|23500918|ref|NP_697045.1| DNA polymerase III subunit beta [Brucella suis 1330]
 gi|163842279|ref|YP_001626683.1| DNA polymerase III subunit beta [Brucella suis ATCC 23445]
 gi|225851548|ref|YP_002731781.1| DNA polymerase III subunit beta [Brucella melitensis ATCC 23457]
 gi|256368467|ref|YP_003105973.1| DNA polymerase III subunit beta [Brucella microti CCM 4915]
 gi|294851412|ref|ZP_06792085.1| DNA polymerase III [Brucella sp. NVSL 07-0026]
 gi|17983990|gb|AAL53123.1| DNA polymerase iii, beta chain [Brucella melitensis bv. 1 str. 16M]
 gi|23346771|gb|AAN28960.1| DNA polymerase III, beta subunit [Brucella suis 1330]
 gi|163673002|gb|ABY37113.1| DNA polymerase III, beta subunit [Brucella suis ATCC 23445]
 gi|225639913|gb|ACN99826.1| DNA polymerase III, beta subunit [Brucella melitensis ATCC 23457]
 gi|255998625|gb|ACU47024.1| DNA polymerase III subunit beta [Brucella microti CCM 4915]
 gi|294820001|gb|EFG37000.1| DNA polymerase III [Brucella sp. NVSL 07-0026]
          Length = 397

 Score =  327 bits (837), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 172/387 (44%), Positives = 246/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T+ERS++L+ L H  R++ER+NTIP+  +VLLQA    L +KA+  ++E+  A  A 
Sbjct: 26  MRVTLERSNLLKSLNHVHRVVERRNTIPILSNVLLQAEGASLAMKATDLDLEVNEATAAM 85

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DGA++     N  G  +++  G S+F LQ  P+S+FP 
Sbjct: 86  VEQAGATTVPAHLLYDIVRKLPDGAEV-MLSTNPDGGSMSVISGKSSFRLQCLPQSDFPE 144

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
                + +SF + +  LK L++RT FA++TEE RYYLNGIFFH  E D  LKL AVATDG
Sbjct: 145 LTAGAFTHSFRIEAQALKRLIDRTQFAISTEETRYYLNGIFFHAIESDGALKLRAVATDG 204

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AE++  +    MP II+PRK V E+ +++   D  V V LS+++I   + S+ ++
Sbjct: 205 HRLARAELEAPSGTEGMPGIIIPRKTVAELQKLVDVPDVVVTVELSDAKIRFTVGSVVLT 264

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDK+L ++  +   +VDRVS +SS R +AVKLS++  +L +T
Sbjct: 265 SKLIDGTFPDYQRVIPSGNDKKLTIDRQDFAASVDRVSTISSERGRAVKLSIADGQLTLT 324

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A + +   Y+  P+DI FN KYLL+I   +S       + VF L  + S   
Sbjct: 325 VNNPDSGSATDELAADYDGDPLDIGFNSKYLLDITGQLSG-----TDAVFMLADAGSPTL 379

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R       +  D  V   YVLMPMR+
Sbjct: 380 VR-------DTGDEDV--LYVLMPMRV 397


>gi|323135990|ref|ZP_08071073.1| DNA polymerase III, beta subunit [Methylocystis sp. ATCC 49242]
 gi|322399081|gb|EFY01600.1| DNA polymerase III, beta subunit [Methylocystis sp. ATCC 49242]
          Length = 372

 Score =  326 bits (836), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 167/387 (43%), Positives = 237/387 (61%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+T+ER+ +L  LGH  R++ER+ TIP+  +VL+ A D  L +KA+  ++EIT   PA 
Sbjct: 1   MKVTIERAALLRALGHVHRVVERRTTIPILANVLIDARDDALTLKATDLDLEITEKAPAE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V   G+ T+ AH LYDIVRKL +GAQ+S     E G ++ +  G S F L + PES+FP 
Sbjct: 61  VGQPGATTLPAHTLYDIVRKLPEGAQVSLDASGEAG-QLTLRSGRSRFNLSTLPESDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
               ++ + F+LA + LK L+E+T FA+++EE RYYLNGI+ H  + D  L L AVATDG
Sbjct: 120 VTSGDFSHRFQLAPADLKRLIEKTQFAISSEETRYYLNGIYIHAMDVDGQLMLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  E+   A  A MP +I+PRKAV E+ R++      V V LS +++  +     ++
Sbjct: 180 HRLARLELPAPAGCADMPGVILPRKAVTEVQRLIEDAQGDVSVELSTNKMRFSFGDALLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP  NDK L V      +AVDRVS +SS R +AVK++L+  KL ++
Sbjct: 240 TKLIDGTFPDYSRVIPAGNDKRLTVERDVFAKAVDRVSTISSERGRAVKMALTEGKLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V NPD G A+E +   Y+  P+D+ FN +YLL+I   + S     D  +F+L    S   
Sbjct: 300 VTNPDQGSAVEELEADYDGAPLDVGFNARYLLDITQQLDS-----DTALFKLADPGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           I+ +D  S         A YVLMPMR+
Sbjct: 355 IQDRDGAS---------ALYVLMPMRV 372


>gi|170748657|ref|YP_001754917.1| DNA polymerase III subunit beta [Methylobacterium radiotolerans JCM
           2831]
 gi|170655179|gb|ACB24234.1| DNA polymerase III, beta subunit [Methylobacterium radiotolerans
           JCM 2831]
          Length = 373

 Score =  326 bits (836), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 170/388 (43%), Positives = 238/388 (61%), Gaps = 18/388 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++TVER+ +L  LGH  R++ER+NTIP+  +VLL+A    L+++A+  +IE+T ++PA 
Sbjct: 1   MRVTVERAALLRSLGHVHRVVERRNTIPILSNVLLRAEGSGLQLRATDLDIEVTESVPAD 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V   G+ TV AH++YDIVRKL DGAQ+S     E G ++ I  G S F L + PE +FP 
Sbjct: 61  VADAGATTVPAHVIYDIVRKLPDGAQVSLETGGESG-QMTIRSGRSRFALGALPEGDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
               E  + FE+A++ LK L+E+T FA++TEE RYYLNGI+ H    E    + AVATDG
Sbjct: 120 LAAGEMPHGFEIAAADLKRLIEKTQFAISTEETRYYLNGIYLHTLETENGPAMRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIE-SLSM 237
           HRLA  E+        MP +IVPRKAV EI ++L     +V V LS ++I L     L++
Sbjct: 180 HRLARVEIPAPQGSVGMPGVIVPRKAVAEIQKLLDDGGETVAVDLSPAKIRLRFAGGLTL 239

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
             +LIDG FP+YQ VIP +NDK L V      +AVDRVS +SS R +AVKL L+  +L +
Sbjct: 240 ISKLIDGTFPDYQRVIPANNDKRLTVERDAFAKAVDRVSTISSERGRAVKLGLAEGRLAL 299

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           +V+NPD G A E ++V Y    +DI FN +YLL+I   +       D  +F+L    S  
Sbjct: 300 SVNNPDSGSATEELDVDYEAAGLDIGFNARYLLDITAQLEG-----DTALFKLADPGSPT 354

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            I+ ++            A YVLMPMR+
Sbjct: 355 LIQDRE---------GAPALYVLMPMRV 373


>gi|161617993|ref|YP_001591880.1| DNA polymerase III subunit beta [Brucella canis ATCC 23365]
 gi|161334804|gb|ABX61109.1| DNA polymerase III, beta subunit [Brucella canis ATCC 23365]
          Length = 397

 Score =  326 bits (835), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 171/387 (44%), Positives = 246/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T+ERS++L+ L H  R++ER+NTIP+  +VLLQA    L +KA+  ++E+  A  A 
Sbjct: 26  MRVTLERSNLLKSLNHVHRVVERRNTIPILSNVLLQAEGASLAMKATDLDLEVNEATAAM 85

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDI+RKL DGA++     N  G  +++  G S+F LQ  P+S+FP 
Sbjct: 86  VEQAGATTVPAHLLYDIIRKLPDGAEV-MLSTNPDGGSMSVISGKSSFRLQCLPQSDFPE 144

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
                + +SF + +  LK L++RT FA++TEE RYYLNGIFFH  E D  LKL AVATDG
Sbjct: 145 LTAGAFTHSFRIEAQALKRLIDRTQFAISTEETRYYLNGIFFHAIESDGALKLRAVATDG 204

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AE++  +    MP II+PRK V E+ +++   D  V V LS+++I   + S+ ++
Sbjct: 205 HRLARAELEAPSGTEGMPGIIIPRKTVAELQKLVDVPDVVVTVELSDAKIRFTVGSVVLT 264

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDK+L ++  +   +VDRVS +SS R +AVKLS++  +L +T
Sbjct: 265 SKLIDGTFPDYQRVIPSGNDKKLTIDRQDFAASVDRVSTISSERGRAVKLSIADGQLTLT 324

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A + +   Y+  P+DI FN KYLL+I   +S       + VF L  + S   
Sbjct: 325 VNNPDSGSATDELAADYDGDPLDIGFNSKYLLDITGQLSG-----TDAVFMLADAGSPTL 379

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R       +  D  V   YVLMPMR+
Sbjct: 380 VR-------DTGDEDV--LYVLMPMRV 397


>gi|239830848|ref|ZP_04679177.1| DNA polymerase III, beta subunit [Ochrobactrum intermedium LMG
           3301]
 gi|239823115|gb|EEQ94683.1| DNA polymerase III, beta subunit [Ochrobactrum intermedium LMG
           3301]
          Length = 385

 Score =  326 bits (835), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 171/387 (44%), Positives = 244/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T+ERS++L+ L H  R++ER+NTIP+  +VLLQA    L +KA+  ++E+  A  A 
Sbjct: 14  MRVTLERSNLLKSLNHVHRVVERRNTIPILSNVLLQAEGASLALKATDLDLEVNEATAAM 73

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DGA++     N  G  +++  G S+F LQ  P+S+FP 
Sbjct: 74  VEQAGATTVPAHLLYDIVRKLPDGAEV-MLSTNPDGGSMSVISGKSSFRLQCLPQSDFPE 132

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
                + +SF + +  LK L++RT FA++TEE RYYLNGIFFH  E D  LKL AVATDG
Sbjct: 133 LTAGAFTHSFRIEAQALKRLIDRTQFAISTEETRYYLNGIFFHAIESDGALKLRAVATDG 192

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AE++  +    MP II+PRK V E+ +++   +  V V LS+++I   + S+ ++
Sbjct: 193 HRLARAELEAPSGTEGMPGIIIPRKTVAELQKLVDVPEVVVTVELSDAKIRFTVGSVVLT 252

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDK+L +       +VDRVS +SS R +AVKLS++  +L +T
Sbjct: 253 SKLIDGTFPDYQRVIPSGNDKKLTIGRQEFAASVDRVSTISSERGRAVKLSIADGQLTLT 312

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A + +   Y+  P+DI FN KYLL+I   +S       + VF L  + S   
Sbjct: 313 VNNPDSGSATDELAADYDADPLDIGFNSKYLLDITSQLSG-----SDAVFMLADAGSPTL 367

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R       +  D  V   YVLMPMR+
Sbjct: 368 VR-------DTGDEDV--LYVLMPMRV 385


>gi|260755858|ref|ZP_05868206.1| DNA polymerase III subunit beta [Brucella abortus bv. 6 str. 870]
 gi|260884883|ref|ZP_05896497.1| DNA polymerase III subunit beta [Brucella abortus bv. 9 str. C68]
 gi|260675966|gb|EEX62787.1| DNA polymerase III subunit beta [Brucella abortus bv. 6 str. 870]
 gi|260874411|gb|EEX81480.1| DNA polymerase III subunit beta [Brucella abortus bv. 9 str. C68]
          Length = 376

 Score =  326 bits (835), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 172/387 (44%), Positives = 245/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T+ERS++L+ L H  R++ER+NTIP+  +VLLQA    L +KA+  ++E+  A  A 
Sbjct: 5   MRVTLERSNLLKSLNHVHRVVERRNTIPILSNVLLQAEGASLAMKATDLDLEVNEATAAM 64

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DGA++     N  G  +++  G S+F LQ  P+S+FP 
Sbjct: 65  VEQAGATTVPAHLLYDIVRKLPDGAEV-MLSTNPDGGSMSVISGKSSFRLQCLPQSDFPE 123

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
                +  SF + +  LK L++RT FA++TEE RYYLNGIFFH  E D  LKL AVATDG
Sbjct: 124 LTAGAFTNSFRIEAQALKRLIDRTQFAISTEETRYYLNGIFFHAIESDGALKLRAVATDG 183

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AE++  +    MP II+PRK V E+ +++   D  V V LS+++I   + S+ ++
Sbjct: 184 HRLARAELEAPSGTEGMPGIIIPRKTVAELQKLVDVPDVVVTVELSDTKIRFTVGSVVLT 243

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDK+L ++  +   +VDRVS +SS R +AVKLS++  +L +T
Sbjct: 244 SKLIDGTFPDYQRVIPSGNDKKLTIDRQDFAASVDRVSTISSERGRAVKLSIADGQLTLT 303

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A + +   Y+  P+DI FN KYLL+I   +S       + VF L  + S   
Sbjct: 304 VNNPDSGSATDELAADYDGDPLDIGFNSKYLLDITGQLSG-----TDAVFMLADAGSPTL 358

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R       +  D  V   YVLMPMR+
Sbjct: 359 VR-------DTGDEDV--LYVLMPMRV 376


>gi|254690319|ref|ZP_05153573.1| DNA polymerase III subunit beta [Brucella abortus bv. 6 str. 870]
 gi|256258573|ref|ZP_05464109.1| DNA polymerase III subunit beta [Brucella abortus bv. 9 str. C68]
          Length = 372

 Score =  326 bits (835), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 172/387 (44%), Positives = 245/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T+ERS++L+ L H  R++ER+NTIP+  +VLLQA    L +KA+  ++E+  A  A 
Sbjct: 1   MRVTLERSNLLKSLNHVHRVVERRNTIPILSNVLLQAEGASLAMKATDLDLEVNEATAAM 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DGA++     N  G  +++  G S+F LQ  P+S+FP 
Sbjct: 61  VEQAGATTVPAHLLYDIVRKLPDGAEV-MLSTNPDGGSMSVISGKSSFRLQCLPQSDFPE 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
                +  SF + +  LK L++RT FA++TEE RYYLNGIFFH  E D  LKL AVATDG
Sbjct: 120 LTAGAFTNSFRIEAQALKRLIDRTQFAISTEETRYYLNGIFFHAIESDGALKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AE++  +    MP II+PRK V E+ +++   D  V V LS+++I   + S+ ++
Sbjct: 180 HRLARAELEAPSGTEGMPGIIIPRKTVAELQKLVDVPDVVVTVELSDTKIRFTVGSVVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDK+L ++  +   +VDRVS +SS R +AVKLS++  +L +T
Sbjct: 240 SKLIDGTFPDYQRVIPSGNDKKLTIDRQDFAASVDRVSTISSERGRAVKLSIADGQLTLT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A + +   Y+  P+DI FN KYLL+I   +S       + VF L  + S   
Sbjct: 300 VNNPDSGSATDELAADYDGDPLDIGFNSKYLLDITGQLSG-----TDAVFMLADAGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R       +  D  V   YVLMPMR+
Sbjct: 355 VR-------DTGDEDV--LYVLMPMRV 372


>gi|192288435|ref|YP_001989040.1| DNA polymerase III subunit beta [Rhodopseudomonas palustris TIE-1]
 gi|192282184|gb|ACE98564.1| DNA polymerase III, beta subunit [Rhodopseudomonas palustris TIE-1]
          Length = 372

 Score =  326 bits (835), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 171/387 (44%), Positives = 245/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+TVER+ +L+ L H  R++ER+NTIP+  +VL++A +  L +KA+  ++E+T  +PA 
Sbjct: 1   MKVTVERAQLLKSLSHVHRVVERRNTIPILGNVLVRAENAQLALKATDLDLEVTETLPAE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               GS TV AH+ YDIVRKL DG+QI    + +    + I  G S F LQ+ PES+FP 
Sbjct: 61  TATAGSTTVPAHMFYDIVRKLPDGSQIVLESDGDRSV-LAIRAGRSRFTLQTLPESDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
               E  ++F L +S +K L++RT FA++TEE RYYLNGI+ H   + +   L AVATDG
Sbjct: 120 LAAGEMSHAFRLPASDVKRLIDRTQFAISTEETRYYLNGIYLHTAGSPKASSLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  ++ + +    MP +IVPRK VGE+ R++   ++ + + LS  +I   + ++ ++
Sbjct: 180 HRLAQLDLTLPSGADGMPGLIVPRKTVGEVQRLIEDTEAEIGIELSTGKIRFTLGNVVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP +NDKELRV+  +   AVDRVS +SS R +AVKL+LS+ KL ++
Sbjct: 240 SKLIDGTFPDYGRVIPQNNDKELRVDKKDFEAAVDRVSTISSERGRAVKLALSAGKLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V NPD G A E + V Y   P+DI FN +YLL+I   I   EV     V +L    S   
Sbjct: 300 VTNPDSGSATEELEVEYASDPLDIGFNSRYLLDIAAQIEG-EV----AVLKLADPGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           I  +D+DSK       +A YVLMPMR+
Sbjct: 355 I--QDRDSK-------SALYVLMPMRV 372


>gi|163849459|ref|YP_001637502.1| DNA polymerase III subunit beta [Methylobacterium extorquens PA1]
 gi|163661064|gb|ABY28431.1| DNA polymerase III, beta subunit [Methylobacterium extorquens PA1]
          Length = 373

 Score =  326 bits (835), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 173/388 (44%), Positives = 239/388 (61%), Gaps = 18/388 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++TVER+ +L+ LGH  R++ER+NTIP+  +VLL+  +  L++KA+  +IE+T  + A 
Sbjct: 1   MRVTVERAALLKSLGHVHRVVERRNTIPILSNVLLRTGENGLQLKATDLDIEVTETVAAD 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V   G+ TV AH++YDIVRKL +GAQ+S     E G ++ I  G S F L + PE +FP 
Sbjct: 61  VLDAGATTVPAHVIYDIVRKLPEGAQVSLETSGETG-QMTIRSGRSRFALGALPEGDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
               E  +SF + ++ LK L+E+T FA++TEE RYYLNGI+FH  E +  LKL AVATDG
Sbjct: 120 LAAGELPHSFAIPAAELKQLIEKTQFAISTEETRYYLNGIYFHTLEVEGALKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  E D       MP IIVPRKAV EI +++     SV+V LS ++I L      + 
Sbjct: 180 HRLARVETDAPEGSRGMPGIIVPRKAVAEIQKLVDDGGESVQVELSPAKIRLTFAGGVIL 239

Query: 239 V-RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +LIDG FP+YQ VIP  NDK L V      +AVDRVS +SS R +AVKL++S  +L +
Sbjct: 240 ISKLIDGTFPDYQRVIPTGNDKRLTVERDAFAKAVDRVSTISSERGRAVKLAVSEGRLAL 299

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           +V NPD G A E ++V Y    +DI FN +YLL+I   +       D  +F+L    S  
Sbjct: 300 SVTNPDAGSATEELDVDYEASALDIGFNARYLLDITAQLQG-----DTALFKLADPGSPT 354

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            I+ +D            A YVLMPMR+
Sbjct: 355 LIQDRD---------GAPALYVLMPMRV 373


>gi|114704370|ref|ZP_01437278.1| DNA polymerase III subunit beta [Fulvimarina pelagi HTCC2506]
 gi|114539155|gb|EAU42275.1| DNA polymerase III subunit beta [Fulvimarina pelagi HTCC2506]
          Length = 374

 Score =  325 bits (833), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 176/389 (45%), Positives = 244/389 (62%), Gaps = 19/389 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+I +ERS++L+ L H  R++ER+NTIP+  +VLL+A    L +KA+  +IEIT  + A 
Sbjct: 1   MRIIIERSNLLKSLAHVHRVVERRNTIPILSNVLLRAKAETLGLKATDLDIEITEEVAAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
            +  G+ TV AHLLYDIVRKL DGA++     +E GT++ +S G SNF LQ  PE++FP 
Sbjct: 61  GEQEGATTVPAHLLYDIVRKLPDGAEVKLVLNSE-GTQMTVSAGRSNFRLQCLPETDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
               E  + F + +  L  L+ERT FA++TEE RYYLNGI+ H  + D  L L AVATDG
Sbjct: 120 ITAGELSHGFTMEAGALARLIERTQFAISTEETRYYLNGIYLHTIDADGTLMLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILS--SKDSSVKVSLSESRIHLNIESLS 236
           HRLA AE+   +    MP IIVPRK VGEI ++L+    D  + V LSES+I   I  + 
Sbjct: 180 HRLARAEMTAPSGSEGMPGIIVPRKTVGEIQKLLADCEDDDEIAVDLSESKIRFKIGRVV 239

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
           M+ +LIDG FP+YQ VIP +NDKEL ++  +   AVDRVS +SS R +AVKL+L+  +L 
Sbjct: 240 MTSKLIDGTFPDYQRVIPQNNDKELTLDRASFSSAVDRVSTISSERGRAVKLTLADSQLT 299

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           +TV++PD G A E + V Y    ++I FN +YLL++   +S      +E +F L    S 
Sbjct: 300 LTVNSPDAGTATEELAVGYESEDLEIGFNARYLLDVTSQLSG-----EEAMFVLADPGSP 354

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             I       K+  D   +  YVLMPMR+
Sbjct: 355 TLI-------KDGGDT--STLYVLMPMRV 374


>gi|153007349|ref|YP_001368564.1| DNA polymerase III subunit beta [Ochrobactrum anthropi ATCC 49188]
 gi|151559237|gb|ABS12735.1| DNA polymerase III, beta subunit [Ochrobactrum anthropi ATCC 49188]
          Length = 385

 Score =  325 bits (833), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 171/387 (44%), Positives = 244/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T+ERS++L+ L H  R++ER+NTIP+  +VLLQA    L +KA+  ++E+  A  A 
Sbjct: 14  MRVTLERSNLLKSLNHVHRVVERRNTIPILSNVLLQAEGASLALKATDLDLEVNEATAAM 73

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DGA++     N  G  +++  G S+F LQ  P+S+FP 
Sbjct: 74  VEQAGATTVPAHLLYDIVRKLPDGAEV-MLSTNPDGGSISVISGKSSFRLQCLPQSDFPE 132

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
                + +SF + +  LK L++RT FA++TEE RYYLNGIFFH   +E  LKL AVATDG
Sbjct: 133 LTAGAFTHSFRIEAQALKRLIDRTQFAISTEETRYYLNGIFFHAIESEGALKLRAVATDG 192

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AE++  +    MP II+PRK V E+ +++   D  V V LS+++I   + S+ ++
Sbjct: 193 HRLARAELEAPSGTEGMPGIIIPRKTVAELQKLVDVPDVVVTVELSDAKIRFTVGSVVLT 252

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDK+L +       +VDRVS +SS R +AVKLS++  +L +T
Sbjct: 253 SKLIDGTFPDYQRVIPSGNDKKLTIGRQEFAASVDRVSTISSERGRAVKLSIADGQLTLT 312

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A + +   Y+  P+DI FN KYLL+I   +S       + VF L  + S   
Sbjct: 313 VNNPDSGSATDELAADYDADPLDIGFNSKYLLDITSQLSG-----SDAVFMLADAGSPTL 367

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R       +  D  V   YVLMPMR+
Sbjct: 368 VR-------DTGDEDV--LYVLMPMRV 385


>gi|297247410|ref|ZP_06931128.1| DNA polymerase III, beta subunit [Brucella abortus bv. 5 str.
           B3196]
 gi|297174579|gb|EFH33926.1| DNA polymerase III, beta subunit [Brucella abortus bv. 5 str.
           B3196]
          Length = 397

 Score =  325 bits (833), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 172/387 (44%), Positives = 245/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T+ERS++L+ L H  R++ER+NTIP+  +VLLQA    L +KA+  ++E+  A  A 
Sbjct: 26  MRVTLERSNLLKSLNHVHRVVERRNTIPILSNVLLQAEGASLAMKATDLDLEVNEATAAM 85

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DGA++     N  G  +++  G S+F LQ  P+S+FP 
Sbjct: 86  VEQAGATTVPAHLLYDIVRKLPDGAEV-MLSTNPDGGSMSVISGKSSFRLQCLPQSDFPE 144

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
                +  SF + +  LK L++RT FA++TEE RYYLNGIFFH  E D  LKL AVATDG
Sbjct: 145 LTAGAFTNSFRIEAQALKRLIDRTQFAISTEETRYYLNGIFFHAIESDGALKLRAVATDG 204

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AE++  +    MP II+PRK V E+ +++   D  V V LS+++I   + S+ ++
Sbjct: 205 HRLARAELEAPSGTEGMPGIIIPRKTVAELQKLVDVPDVVVTVELSDTKIRFTVGSVVLT 264

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDK+L ++  +   +VDRVS +SS R +AVKLS++  +L +T
Sbjct: 265 SKLIDGTFPDYQRVIPSGNDKKLTIDRQDFAASVDRVSTISSERGRAVKLSIADGQLTLT 324

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A + +   Y+  P+DI FN KYLL+I   +S       + VF L  + S   
Sbjct: 325 VNNPDSGSATDELAADYDGDPLDIGFNSKYLLDITGQLSG-----TDAVFMLADAGSPTL 379

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R       +  D  V   YVLMPMR+
Sbjct: 380 VR-------DTGDEDV--LYVLMPMRV 397


>gi|158422637|ref|YP_001523929.1| DNA polymerase III subunit beta [Azorhizobium caulinodans ORS 571]
 gi|158329526|dbj|BAF87011.1| DNA polymerase III beta chain [Azorhizobium caulinodans ORS 571]
          Length = 372

 Score =  325 bits (833), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 166/387 (42%), Positives = 242/387 (62%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+TVER+++L+ L H  R++ER+NTIP+  +VL++     L +KA+  ++E+   +PA 
Sbjct: 1   MKVTVERAELLKSLSHVHRVVERRNTIPILANVLIRTGTNGLSLKATDLDLEVVETVPAE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V   G+ TV AH+LYDIVRKL DG+Q+      E G  + +  G + F LQ+ PE++FP 
Sbjct: 61  VGQDGATTVPAHVLYDIVRKLPDGSQVQLEAGGERG-NLTVRAGRARFTLQTLPEADFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEE--DLKLCAVATDG 178
               ++ +SF++  +  + LV++T FA++TEE RYYLNGI+ H+ +     KL AVATDG
Sbjct: 120 LAAGDFSHSFKVKGAEFRRLVDKTQFAISTEETRYYLNGIYLHVADAAGTAKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AE+D     A +P +IVPRK V EI ++L  KD+ V VSLS ++I + + ++ ++
Sbjct: 180 HRLAQAELDAPEGSAGLPGVIVPRKTVAEIQKLLEDKDAEVTVSLSTTKIRVAVGAIVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP  NDK L V+ ++   AVDRVS +SS R +AVKLS+   KL ++
Sbjct: 240 SKLIDGTFPDYGRVIPAGNDKILLVDKSDFAAAVDRVSTVSSERGRAVKLSIQDGKLTLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V NPD G A E + V Y   P+DI FN +YLL+I   +       D    +L    S   
Sbjct: 300 VTNPDSGSATEELEVDYAAEPLDIGFNSRYLLDITSQLEG-----DTAELKLADPGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R    DS      K ++ YVLMPMR+
Sbjct: 355 VR----DS-----TKTDSLYVLMPMRV 372


>gi|148560207|ref|YP_001258051.1| DNA polymerase III subunit beta [Brucella ovis ATCC 25840]
 gi|148371464|gb|ABQ61443.1| DNA polymerase III, beta subunit [Brucella ovis ATCC 25840]
          Length = 397

 Score =  325 bits (832), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 171/387 (44%), Positives = 246/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T+ERS++L+ L H  R++ER+NTIP+  +VLLQA    L +KA+  ++E+  A  A 
Sbjct: 26  MRVTLERSNLLKSLNHVHRVVERRNTIPILSNVLLQAEGASLAMKATDLDLEVNEATAAM 85

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDIVRKL DGA++     N  G  +++  G S+F LQ  P+S+FP 
Sbjct: 86  VEQAGATTVPAHLLYDIVRKLPDGAEV-MLSTNPDGGSMSVISGKSSFRLQCLPQSDFPE 144

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
                + +SF + +  LK L++RT FA++TEE RYYLNGIFFH  E D  LKL AVATDG
Sbjct: 145 LTAGAFTHSFRIEAQALKRLIDRTQFAISTEETRYYLNGIFFHAIESDGALKLRAVATDG 204

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AE++  +    MP II+PRK V E+ +++   D  V V LS+++I   + S+ ++
Sbjct: 205 HRLARAELEAPSGTEGMPGIIIPRKTVAELQKLVDVPDVVVTVELSDAKIRFTVGSVVLT 264

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDK+L ++  +   +VDRVS +SS R +AVKLS++  +L +T
Sbjct: 265 SKLIDGTFPDYQRVIPSGNDKKLTIDRQDFAASVDRVSTISSERGRAVKLSIADGQLTLT 324

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V++PD G A + +   Y+  P+DI FN KYLL+I   +S       + VF L  + S   
Sbjct: 325 VNSPDSGSATDELAADYDGDPLDIGFNSKYLLDITGQLSG-----TDAVFMLADAGSPTL 379

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R       +  D  V   YVLMPMR+
Sbjct: 380 VR-------DTGDEDV--LYVLMPMRV 397


>gi|92115635|ref|YP_575364.1| DNA polymerase III subunit beta [Nitrobacter hamburgensis X14]
 gi|91798529|gb|ABE60904.1| DNA polymerase III, beta subunit [Nitrobacter hamburgensis X14]
          Length = 372

 Score =  324 bits (830), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 168/387 (43%), Positives = 243/387 (62%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+TVER+ +L+ LGH  R++ER+NTIP+  +VL++A +  L +KA+  ++E+T  + A 
Sbjct: 1   MKVTVERAQLLKSLGHVHRVVERRNTIPILGNVLVRAENARLSLKATDLDLEVTETLAAE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               G+ TV AH+ YDIVRKL DGAQI    + +    + I  G S F LQ+ PE++FP 
Sbjct: 61  TATGGATTVPAHIFYDIVRKLPDGAQIVLEGDGDRSV-LAIRAGRSRFTLQTLPENDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
               E  +SF+LA++ +K L++RT FA++TEE RYYLNGI+ H   + ++  L  VATDG
Sbjct: 120 LAAGEMTHSFKLAAADIKRLIDRTQFAISTEETRYYLNGIYLHSAGSAKNATLRGVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  ++ +      MP +I+PRK VGE+ R++   ++ V + LS+ +I   I ++ ++
Sbjct: 180 HRLAQVDLALPNGAEGMPGVIIPRKTVGEVQRLIEDNEAEVGIELSQGKIRFTIGNVVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP +NDKEL V+  +   AVDRVS +SS R +AVKL+LS+ KL ++
Sbjct: 240 SKLIDGTFPDYGRVIPQNNDKELIVDKKDFEAAVDRVSTISSERGRAVKLALSAGKLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V NPD G A E + V Y   P+DI FN +YLL+I   I       +  V +L    S   
Sbjct: 300 VTNPDSGSATEELEVEYASEPLDIGFNSRYLLDIAAQIEG-----EGAVLKLADPGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +   DKDSK        A YVLMPMR+
Sbjct: 355 VH--DKDSK-------GALYVLMPMRV 372


>gi|218528085|ref|YP_002418901.1| DNA polymerase III subunit beta [Methylobacterium chloromethanicum
           CM4]
 gi|240136785|ref|YP_002961252.1| DNA polymerase III, beta-subunit [Methylobacterium extorquens AM1]
 gi|254558655|ref|YP_003065750.1| DNA polymerase III, beta-subunit [Methylobacterium extorquens DM4]
 gi|218520388|gb|ACK80973.1| DNA polymerase III, beta subunit [Methylobacterium chloromethanicum
           CM4]
 gi|240006749|gb|ACS37975.1| DNA polymerase III, beta-subunit [Methylobacterium extorquens AM1]
 gi|254265933|emb|CAX21682.1| DNA polymerase III, beta-subunit [Methylobacterium extorquens DM4]
          Length = 373

 Score =  324 bits (830), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 172/388 (44%), Positives = 239/388 (61%), Gaps = 18/388 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++TVER+ +L+ LGH  R++ER+NTIP+  +VLL+  +  L++KA+  +IE+T  + A 
Sbjct: 1   MRVTVERAALLKSLGHVHRVVERRNTIPILSNVLLRTGENGLQLKATDLDIEVTETVAAD 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V   G+ TV AH++YDIVRKL +GAQ+S     E G ++ I  G S F L + PE +FP 
Sbjct: 61  VLDAGATTVPAHVIYDIVRKLPEGAQVSLETSGETG-QMTIRSGRSRFALGALPEGDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
               E  +SF + ++ LK L+E+T FA++TEE RYYLNGI+FH  E +  LKL AVATDG
Sbjct: 120 LAAGELPHSFAIPAAELKQLIEKTQFAISTEETRYYLNGIYFHTLEVEGALKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  E +       MP IIVPRKAV EI +++     SV+V LS ++I L      + 
Sbjct: 180 HRLARVETEAPEGSRGMPGIIVPRKAVAEIQKLVDDGGESVQVELSPAKIRLTFAGGVIL 239

Query: 239 V-RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +LIDG FP+YQ VIP  NDK L V      +AVDRVS +SS R +AVKL++S  +L +
Sbjct: 240 ISKLIDGTFPDYQRVIPTGNDKRLTVERDAFAKAVDRVSTISSERGRAVKLAVSEGRLAL 299

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           +V NPD G A E ++V Y    +DI FN +YLL+I   +       D  +F+L    S  
Sbjct: 300 SVTNPDAGSATEELDVDYEASALDIGFNARYLLDITAQLQG-----DTALFKLADPGSPT 354

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            I+ +D            A YVLMPMR+
Sbjct: 355 LIQDRD---------GAPALYVLMPMRV 373


>gi|316931398|ref|YP_004106380.1| DNA polymerase III subunit beta [Rhodopseudomonas palustris DX-1]
 gi|315599112|gb|ADU41647.1| DNA polymerase III, beta subunit [Rhodopseudomonas palustris DX-1]
          Length = 372

 Score =  323 bits (829), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 171/387 (44%), Positives = 243/387 (62%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+TVER+ +L+ L H  R++ER+NTIP+  +VL++A +  L +KA+  ++E+T  +PA 
Sbjct: 1   MKVTVERAQLLKSLSHVHRVVERRNTIPILGNVLVRAENAQLALKATDLDLEVTETLPAE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               GS TV AH+ YDIVRKL DG+QI    + +    + I  G S F LQ+ PES+FP 
Sbjct: 61  TATAGSTTVPAHMFYDIVRKLPDGSQIVLESDGDRSV-LAIRAGRSRFTLQTLPESDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
               E  ++F L +S +K L++RT FA++TEE RYYLNGI+ H   +     L AVATDG
Sbjct: 120 LAAGEMSHAFRLPASDVKRLIDRTQFAISTEETRYYLNGIYLHTAGSSGAASLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  ++ + +    MP +IVPRK VGE+ R++   ++ + + LS  +I   + ++ ++
Sbjct: 180 HRLAQLDLTLPSGADGMPGVIVPRKTVGEVQRLIEDTEAEIGIELSTGKIRFTLGNVVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP +NDKEL V+  +   AVDRVS +SS R +AVKL+LS+ KL ++
Sbjct: 240 SKLIDGTFPDYGRVIPQNNDKELLVDKKDFEAAVDRVSTISSERGRAVKLALSAGKLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V NPD G A E + V Y   P+DI FN +YLL+I   I   EV     V RL    S   
Sbjct: 300 VTNPDSGSATEELEVEYASDPLDIGFNSRYLLDIAAQIEG-EV----AVLRLADPGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           I  +D+DSK       +A YVLMPMR+
Sbjct: 355 I--QDRDSK-------SALYVLMPMRV 372


>gi|220920056|ref|YP_002495357.1| DNA polymerase III subunit beta [Methylobacterium nodulans ORS
           2060]
 gi|219944662|gb|ACL55054.1| DNA polymerase III, beta subunit [Methylobacterium nodulans ORS
           2060]
          Length = 373

 Score =  323 bits (827), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 170/388 (43%), Positives = 240/388 (61%), Gaps = 18/388 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++TVER+ +L  LGH  R++ER+NTIP+  +VLL+++   L++KA+  +IE+T  IPA 
Sbjct: 1   MRVTVERAALLRSLGHVHRVVERRNTIPILSNVLLRSSADGLQLKATDLDIEVTETIPAD 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V   G+ TV AH++YDIVRKL +GAQ+S     + G ++ I  G S F L + PE++FP 
Sbjct: 61  VADGGATTVPAHVIYDIVRKLPEGAQVSLETTGDTG-QMLIRSGRSRFTLGALPETDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
               E  + F+L ++ LK L+++T FA++TEE RYYLNGIFFH    E  +KL AVATDG
Sbjct: 120 LAAGELPHRFQLQAAELKKLIDKTQFAISTEETRYYLNGIFFHTIEAEGGVKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  E+        MP IIVPRKAV EI +++     SV V +S +++     +  M 
Sbjct: 180 HRLARVEMPAPEGSHGMPGIIVPRKAVAEIQKLVEDGGDSVGVEISSAKVRFTFSTGVML 239

Query: 239 V-RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +LIDG FP+YQ VIP  NDK L V      +AVDRVS +SS R +AVKL+++  +L +
Sbjct: 240 ISKLIDGTFPDYQRVIPTGNDKLLTVERDQFAKAVDRVSTISSERGRAVKLAVAGGRLSL 299

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           +V+NPD G A E ++  Y   P+DI FN +YLL+I   +       D  +F+L    S  
Sbjct: 300 SVNNPDSGSATEELDADYEAAPLDIGFNARYLLDITAQLDG-----DTALFKLADPGSPT 354

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            I+ KD            A YVLMPMR+
Sbjct: 355 LIQDKD---------GAPALYVLMPMRV 373


>gi|39933082|ref|NP_945358.1| DNA polymerase III subunit beta [Rhodopseudomonas palustris CGA009]
 gi|39652707|emb|CAE25446.1| DNA polymerase III beta subunit [Rhodopseudomonas palustris CGA009]
          Length = 372

 Score =  322 bits (826), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 170/387 (43%), Positives = 244/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+TVER+ +L+ L H  R++ER+NTIP+  +VL++A +  L +KA+  ++E+T  +PA 
Sbjct: 1   MKVTVERAQLLKSLSHVHRVVERRNTIPILGNVLVRAENAQLALKATDLDLEVTETLPAE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               GS TV AH+ YDIVRKL DG+QI    + +    + I  G S F LQ+ PES+FP 
Sbjct: 61  TATAGSTTVPAHMFYDIVRKLPDGSQIVLESDGDRSV-LAIRAGRSRFTLQTLPESDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
               E  ++F L +S +K L++RT FA++TEE RYYLNGI+ H   + +   L AVATDG
Sbjct: 120 LAAGEMSHAFRLPASDVKRLIDRTQFAISTEETRYYLNGIYLHTAGSPKASSLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  ++ + +    MP +IVPRK VGE+ R++   ++ + + LS  +I   + ++ ++
Sbjct: 180 HRLAQLDLTLPSGADGMPGVIVPRKTVGEVQRLIEDTEAEIGIELSTGKIRFTLGNVVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP +NDKEL V+  +   AVDRVS +SS R +AVKL+LS+ KL ++
Sbjct: 240 SKLIDGTFPDYGRVIPQNNDKELLVDKKDFEAAVDRVSTISSERGRAVKLALSAGKLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V NPD G A E + V Y   P+DI FN +YLL+I   I   EV     V +L    S   
Sbjct: 300 VTNPDSGSATEELEVEYASDPLDIGFNSRYLLDIAAQIEG-EV----AVLKLADPGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           I  +D+DSK       +A YVLMPMR+
Sbjct: 355 I--QDRDSK-------SALYVLMPMRV 372


>gi|296445221|ref|ZP_06887181.1| DNA polymerase III, beta subunit [Methylosinus trichosporium OB3b]
 gi|296257395|gb|EFH04462.1| DNA polymerase III, beta subunit [Methylosinus trichosporium OB3b]
          Length = 371

 Score =  320 bits (820), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 176/387 (45%), Positives = 240/387 (62%), Gaps = 18/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKIT+ER+ +L  LGH  R++ER+ TIP+  +VLL A D  L +KA+  ++EIT    A 
Sbjct: 1   MKITIERAALLRALGHVHRVVERRTTIPILANVLLDAAD-GLLLKATDLDLEITEKAAAE 59

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           +   G+ T+ AH LYDIVRKL DGAQ+S     E G  + +  G S F LQS PES+FP 
Sbjct: 60  IGQKGATTLPAHTLYDIVRKLPDGAQVSLEGTGEQGLFL-LRSGRSRFQLQSLPESDFPD 118

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK--LCAVATDG 178
               E+ + F+LA + LK L+ +T FA+++EE RYYLNGIF H  E +    L AVATDG
Sbjct: 119 VTSGEFSHRFQLAPADLKKLILKTQFAISSEETRYYLNGIFLHSTEVEGHQLLRAVATDG 178

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  E+   A  A MP +I+PRKAV E+LR++     +V++ LS +++  +     ++
Sbjct: 179 HRLARVELPAPAGAAGMPGVILPRKAVNEVLRLVEDAQGAVEIELSTNKMRFSFGETVLT 238

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP  NDK L V   + R+AVDRVS +SS R +AVKL+LS  KL ++
Sbjct: 239 TKLIDGTFPDYGRVIPAGNDKRLTVERASFREAVDRVSTISSERGRAVKLALSEGKLVLS 298

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V NPD G A+E +   Y+  P+DI FN +YLL+I D + S     D  +FRL    S   
Sbjct: 299 VTNPDQGSAVEEIEADYDGPPIDIGFNSRYLLDIADQLDS-----DTALFRLADPGSPTL 353

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           I+ +D  S         A YVLMPMR+
Sbjct: 354 IQDRDGAS---------ALYVLMPMRV 371


>gi|75674201|ref|YP_316622.1| DNA polymerase III subunit beta [Nitrobacter winogradskyi Nb-255]
 gi|74419071|gb|ABA03270.1| DNA polymerase III, beta subunit [Nitrobacter winogradskyi Nb-255]
          Length = 372

 Score =  319 bits (817), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 164/387 (42%), Positives = 239/387 (61%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+TVER+ +L+ LGH  R++ER+NTIP+  +VL++A +  L +KA+  ++E+T  + A 
Sbjct: 1   MKVTVERAQLLKSLGHVHRVVERRNTIPILGNVLVRAENAKLSLKATDLDLEVTETLAAE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               GS TV AH+ YDI+RKL DGAQI    + +    + I  G S F LQ+ PE++FP 
Sbjct: 61  TGTVGSTTVPAHMFYDIIRKLPDGAQIVLEGDGDRSV-LTIRAGRSRFTLQTLPENDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
               E  +SF LA++ LK L++RT FA++TEE RYYLNGI+ H      +  L  VATDG
Sbjct: 120 LAAGEMTHSFTLAAADLKRLIDRTQFAISTEETRYYLNGIYLHGAGTANNATLRGVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  ++ +      MP +I+PRK VGE+ R++   ++ + + LS+ +I   + ++ ++
Sbjct: 180 HRLAQLDLALPKGAEGMPGVIIPRKTVGEVQRLIEDSEAEIGIELSQGKIRFTLGNVVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP +NDKEL V+  +   AVDRVS +SS R +AVKL+LS+ KL ++
Sbjct: 240 SKLIDGTFPDYGRVIPQNNDKELVVDKKDFEAAVDRVSTISSERGRAVKLALSAGKLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V NPD G A E + V Y    +DI FN +YLL+I   I       +  V +L    S   
Sbjct: 300 VTNPDSGSATEELEVEYASDALDIGFNSRYLLDIAAQIEG-----EAAVLKLADPGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +   D+DS+        A YVLMPMR+
Sbjct: 355 VH--DRDSR-------GALYVLMPMRV 372


>gi|254472242|ref|ZP_05085642.1| DNA polymerase III, beta subunit [Pseudovibrio sp. JE062]
 gi|211958525|gb|EEA93725.1| DNA polymerase III, beta subunit [Pseudovibrio sp. JE062]
          Length = 372

 Score =  318 bits (815), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 167/387 (43%), Positives = 244/387 (63%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+T+ER+++L+ L H  R++ER+NTIP+  +V+LQA  G L++KA+  ++E+  +I A 
Sbjct: 1   MKVTLERTELLKSLTHVHRVVERRNTIPILSNVMLQAEGGNLKLKATDLDLEVVESIAAM 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AH++Y+IVRKL DG+Q+      +  T + I  G S F LQ  P ++FP 
Sbjct: 61  VETPGATTVPAHMIYEIVRKLPDGSQVVLETSGDDST-MEIRAGRSRFALQILPVTDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINE--EDLKLCAVATDG 178
               E+ +SF + +  ++ L++ T FA++TEE RYYLNGI+ H  +  E L+  AVATDG
Sbjct: 120 LTAGEFSHSFTMTAGGIRKLIDSTQFAISTEETRYYLNGIYMHSLDIGEGLRFRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AE++       MP IIVPRK VGEI ++L   +  +KV +SE++I   I  + ++
Sbjct: 180 HRLAQAELEAPEGSDGMPGIIVPRKTVGEIQKLLDDPEVEIKVEISETKIRFTIGDIILT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y+ VIP  NDKELRV+    ++AVDRVS ++S R +AVK++LS  K+ +T
Sbjct: 240 SKLIDGTFPDYERVIPKGNDKELRVDRDVFKEAVDRVSTIASDRGRAVKMALSEGKIVLT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V NPD G A E + V Y+    +I FN KYLL+I   + +     D  +F L  S S   
Sbjct: 300 VTNPDSGTATEEVAVEYDNEEFEIGFNSKYLLDIAAQLEA-----DTALFTLADSGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           IR +  D          A YVLMPMR+
Sbjct: 355 IRDEGSD---------EAIYVLMPMRV 372


>gi|90421530|ref|YP_529900.1| DNA polymerase III subunit beta [Rhodopseudomonas palustris BisB18]
 gi|90103544|gb|ABD85581.1| DNA polymerase III, beta subunit [Rhodopseudomonas palustris
           BisB18]
          Length = 372

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 172/387 (44%), Positives = 242/387 (62%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+TVER+ +L+ LGH  R++ER+NTIP+  +VLL+A  G L +KA+  ++E+T  +PA 
Sbjct: 1   MKVTVERAQLLKSLGHVHRVVERRNTIPILGNVLLRAEKGRLSLKATDLDLEVTETLPAE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               GS TV AH+ YDIVRKL DG+QI    + E    + I  G S F LQ+ PE++FP 
Sbjct: 61  TATGGSTTVPAHMFYDIVRKLPDGSQIVLESDGERAV-LAIRAGRSRFTLQTLPENDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFH--INEEDLKLCAVATDG 178
               E  +SF L ++ +K L++RT FA++TEE RYYLNGI+ H         L AVATDG
Sbjct: 120 LAAGEMTHSFTLTAADVKRLIDRTQFAISTEETRYYLNGIYLHGAGTAAAATLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  ++ + +  A MP +IVPRK VGE+ R++   +++V + LS  +I   +  + ++
Sbjct: 180 HRLAQVDLPLPSGAAGMPGVIVPRKTVGEVQRLIEDTEAAVGIELSVGKIRFTLGDVVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP +NDKEL V+  +   AVDRVS +SS R +AVKL+LS+ KL ++
Sbjct: 240 SKLIDGTFPDYGRVIPQNNDKELVVDKKDFEAAVDRVSTISSERGRAVKLALSAGKLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V NPD G A E + V Y    +DI FN +YLL+I   I   EV     V +L    S   
Sbjct: 300 VTNPDSGSATEELEVEYASDALDIGFNSRYLLDIAAQIEG-EV----AVLKLADPGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +  +D+D+K        A YVLMPMR+
Sbjct: 355 V--QDRDAK-------GALYVLMPMRV 372


>gi|27375940|ref|NP_767469.1| DNA polymerase III subunit beta [Bradyrhizobium japonicum USDA 110]
 gi|27349078|dbj|BAC46094.1| DNA polymerase III beta chain [Bradyrhizobium japonicum USDA 110]
          Length = 372

 Score =  316 bits (810), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 170/389 (43%), Positives = 241/389 (61%), Gaps = 21/389 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+TVER+ +L+ LGH  R++ER+NTIP+  +VL++A +  L +KA+  ++E+T  +PA 
Sbjct: 1   MKVTVERAQLLKSLGHVHRVVERRNTIPILGNVLVRAENAKLSLKATDLDLEVTETLPAE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               GS TV AH+ YDIVRKL DG+QI    + +    + I  G S F LQ+ PE++FP 
Sbjct: 61  TATAGSTTVPAHMFYDIVRKLPDGSQIVLEADGDRAV-LAIRAGRSRFTLQTLPENDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
               +  +SF LA+  +K L++RT FA++TEE RYYLNGI+ H     +   L  VATDG
Sbjct: 120 LAAGDMSHSFSLAAKDVKRLIDRTQFAISTEETRYYLNGIYLHAAGTAKAATLRGVATDG 179

Query: 179 HRLAVAEVDIVAQIAK--MPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLS 236
           HRLA  ++D+V       MP +IVPRK VGE+ R++   ++ + + LS+++I   I ++ 
Sbjct: 180 HRLA--QLDLVQPKGADGMPGVIVPRKTVGEVQRLIEDTEAEMTIELSQAKIRFTIGNVV 237

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
           ++ +LIDG FP+Y  VIP  NDKEL V+  +   AVDRVS +SS R +AVKLSLS  KL 
Sbjct: 238 LTSKLIDGTFPDYGRVIPQGNDKELVVDKKDFENAVDRVSTISSERGRAVKLSLSPGKLV 297

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           ++V NPD G A E + V Y    +DI FN +YLL+I   I   EV       RL    S 
Sbjct: 298 LSVTNPDSGSATEELEVEYASDALDIGFNSRYLLDIAAQIEG-EV----ATLRLADPGSP 352

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +  +D+D K       +A YVLMPMR+
Sbjct: 353 TLV--QDRDDK-------SALYVLMPMRV 372


>gi|163867416|ref|YP_001608613.1| DNA polymerase III subunit beta [Bartonella tribocorum CIP 105476]
 gi|161017060|emb|CAK00618.1| DNA polymerase III, beta chain [Bartonella tribocorum CIP 105476]
          Length = 373

 Score =  315 bits (808), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 165/387 (42%), Positives = 254/387 (65%), Gaps = 16/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ITV+R+  L+ LG   R++ER+NT+P+  +VL+ A +G +++K +  ++E+T +   +
Sbjct: 1   MRITVDRNQFLKSLGRVHRVVERRNTVPILSNVLIDAENGHVQLKTTDLDLEVTESFTVN 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AHLLYDI+RKL DG +I    +    + +++  G  +F LQ  P+++FP 
Sbjct: 61  VEHAGATTVPAHLLYDIIRKLPDGNEIVLSVDENQASTMSVVSGCVHFQLQCLPKADFPE 120

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFH-INEEDLKLCAVATDGH 179
           +   ++ Y F L++S LK+L++ T FA++TEE RYYLNGI+FH IN++ LKL  VATDGH
Sbjct: 121 SLPGQFGYRFSLSASGLKHLLDCTQFAISTEETRYYLNGIYFHVINDDVLKLRLVATDGH 180

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSK-DSSVKVSLSESRIHLNIESLSMS 238
           RLA  E++  + +  MP +IVPRKAVGE+ ++LS + D  V + LSE++I  ++ S+  +
Sbjct: 181 RLAQVEMEAPSGVEGMPGVIVPRKAVGELQKLLSEENDGDVCIELSETKIRFSVGSVIFT 240

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+YQ VIP  NDKEL VN  +   AVDRVS +SS R +AVKL++   +L + 
Sbjct: 241 SKLIDGTFPDYQRVIPLGNDKELVVNRQDFSSAVDRVSTISSDRGRAVKLTIEHGQLRLV 300

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V++PD G A + ++V Y+  P++I FN +YLL+I   +SS     DE+VF L  + +   
Sbjct: 301 VNSPDSGSAEDQLSVTYSSEPLEIGFNSRYLLDIAGQLSS-----DEMVFMLAEAGAPAL 355

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           IR  D           +  YVLMP+R+
Sbjct: 356 IRDND---------DADVLYVLMPIRV 373


>gi|240849790|ref|YP_002971178.1| DNA polymerase III subunit beta [Bartonella grahamii as4aup]
 gi|240266913|gb|ACS50501.1| DNA polymerase III subunit beta [Bartonella grahamii as4aup]
          Length = 373

 Score =  315 bits (806), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 169/388 (43%), Positives = 255/388 (65%), Gaps = 18/388 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ITV+RS  L+ LG   R++ER+NT+P+  +VL+ A +G +++KA+  ++E+T +   +
Sbjct: 1   MRITVDRSQFLKSLGRVHRVVERRNTVPILSNVLIDAENGSVQLKATDLDLEVTESFAVN 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESEFP 119
           V   G+ TV AHLLYDI+RKL D  ++     EN+ GT +++  G ++F LQ  P+++FP
Sbjct: 61  VKQAGATTVPAHLLYDIIRKLPDSNEVVLSVDENQAGT-MSVVSGCAHFQLQCLPKADFP 119

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFH-INEEDLKLCAVATDG 178
            +   ++ Y F L++S LK+L++ T FA++TEE RYYLNGI+ H IN+  LKL  VATDG
Sbjct: 120 ESLPGQFGYRFSLSASSLKHLLDCTQFAISTEETRYYLNGIYLHVINDGVLKLRLVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSK-DSSVKVSLSESRIHLNIESLSM 237
           HRLA  E++  + +  MP +IVPRKAVGE+ ++LS + DS V + LSE++I  ++ S+  
Sbjct: 180 HRLAQVEMEAPSGVEGMPGVIVPRKAVGELQKLLSEENDSDVCIELSETKIRFSVGSVIF 239

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +LIDG FP+YQ VIP  NDKEL VN  +   AVDRVS +SS R +AVKL++   +L +
Sbjct: 240 TSKLIDGTFPDYQRVIPLGNDKELIVNRQDFSSAVDRVSTISSDRGRAVKLTIEHRQLRL 299

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
            V++PD G A + ++V Y   P++I FN +YLL+I   +SS     DE+VF L  + +  
Sbjct: 300 VVNSPDSGSAEDQLSVTYASEPLEIGFNSRYLLDIAGQLSS-----DEMVFMLAEAGAPA 354

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            IR  D           +  YVLMP+R+
Sbjct: 355 LIRDND---------DADVLYVLMPIRV 373


>gi|85713965|ref|ZP_01044954.1| DNA polymerase III subunit beta [Nitrobacter sp. Nb-311A]
 gi|85699091|gb|EAQ36959.1| DNA polymerase III subunit beta [Nitrobacter sp. Nb-311A]
          Length = 372

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 163/387 (42%), Positives = 239/387 (61%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+TVER+ +L+ L H  R++ER+NTIP+  +VL++A +  L +KA+  ++E+T  + A 
Sbjct: 1   MKVTVERAQLLKSLSHVHRVVERRNTIPILGNVLVRAENAKLSLKATDLDLEVTETLSAE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               GS +V AH+ YDIVRKL +GAQI    + +    + I  G S F LQ+ PE++FP 
Sbjct: 61  TGTIGSTSVPAHMFYDIVRKLPEGAQILLEGDGDRSV-LAIRAGRSRFTLQTLPENDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
               E  ++F LA++ LK L++RT FA++TEE RYYLNGI+ H   N +   L  VATDG
Sbjct: 120 LAAGEMTHAFTLAAADLKRLIDRTQFAISTEETRYYLNGIYLHGAGNAKSATLRGVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  ++ +      MP +I+PRK VGE+ R++   ++ + + LS+ +I   I ++ ++
Sbjct: 180 HRLAQLDLALPKGAEGMPGVIIPRKTVGEVQRLIEDSEAEIGIELSQGKIRFTIGNVVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP +NDKEL V+  +   AVDRVS +SS R +AVKL+LS+ KL ++
Sbjct: 240 SKLIDGTFPDYGRVIPQNNDKELVVDKKDFEAAVDRVSTISSERGRAVKLALSAGKLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V NPD G A E + V Y    +DI FN +YLL+I   I       +  V +L    S   
Sbjct: 300 VTNPDSGSATEELEVEYASDALDIGFNSRYLLDIAAQIEG-----EAAVLKLADPGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +   D+DS+        A YVLMPMR+
Sbjct: 355 VH--DRDSR-------GALYVLMPMRV 372


>gi|182679952|ref|YP_001834098.1| DNA polymerase III subunit beta [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182635835|gb|ACB96609.1| DNA polymerase III, beta subunit [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 371

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 165/388 (42%), Positives = 237/388 (61%), Gaps = 20/388 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQAN-DGLLEIKASGPEIEITGAIPA 59
           MK+T+ER+ +L+ LGH  R++ER+NTIP+  +VLL ++ DGLL +KA+  ++E+T  + A
Sbjct: 1   MKVTLERAALLKALGHVHRVVERRNTIPILSNVLLHSDGDGLL-LKATDLDLEVTERLTA 59

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G  T+ AH+LYDIVRKL DG+QIS   E      + +  G S F LQS PES+FP
Sbjct: 60  ETGTQGGTTLPAHILYDIVRKLPDGSQISL--ETTEAGPLQLRSGRSRFTLQSLPESDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATD 177
                 +  +F L +  LK L+++T FA+++EE RYYLNGIF H  E +  + L AVATD
Sbjct: 118 DLAAGTFEQTFTLKAGDLKRLIDKTQFAISSEETRYYLNGIFMHTTEVEGHVMLRAVATD 177

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLA  E+      + MP II+PRK V E+ +++  +   VK+ +S ++I      + +
Sbjct: 178 GHRLARVEIPAPQGASGMPGIIIPRKTVAEVQKLVEDQAQEVKLEVSPTKIRFTFGEVVL 237

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +LIDG FP+Y  VIP  NDK L V+    + AVDRVS +SS R +AVKL+L+  KL +
Sbjct: 238 TSKLIDGTFPDYARVIPSGNDKFLTVDRGPFQDAVDRVSTISSERGRAVKLALAEGKLTL 297

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           +V NPD G A+E + V Y+  P+DI FN +YLL+I   + S     D  +F+     S  
Sbjct: 298 SVTNPDSGSAVEELEVDYDAAPIDIGFNARYLLDIAAQLDS-----DTALFKFADPGSPT 352

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            +  +D  S         A YVLMPMR+
Sbjct: 353 LVLDRDGAS---------ALYVLMPMRV 371


>gi|49474937|ref|YP_032978.1| DNA polymerase III subunit beta [Bartonella henselae str.
           Houston-1]
 gi|49237742|emb|CAF26934.1| DNA polymerase III, beta chain [Bartonella henselae str. Houston-1]
          Length = 373

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 169/387 (43%), Positives = 253/387 (65%), Gaps = 16/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ITV+R+ +L+ LG   R++ER+NT+P+  +VL+ A+   +++KA+  ++E+T +  A+
Sbjct: 1   MRITVDRNQLLKSLGRVHRVVERRNTVPILSNVLIDADKNGVQLKATDLDLEVTESFVAN 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           +   G+ITV AHLLYDIVRKL DG++I    +    + +++  G +NF LQ  P+ +FP 
Sbjct: 61  IKQEGAITVPAHLLYDIVRKLPDGSEIVLSVDMNQASTMSVVSGCANFQLQCLPKVDFPE 120

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFH-INEEDLKLCAVATDGH 179
           +   ++ Y F L++S LK+L++ T FA++TEE RYYLNGI+FH I++  LKL  VATDGH
Sbjct: 121 SLPGQFGYRFSLSTSGLKHLLDCTQFAISTEETRYYLNGIYFHVIDDGVLKLRLVATDGH 180

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSK-DSSVKVSLSESRIHLNIESLSMS 238
           RLA  +++  + +  MP +IVPRK VGE+ ++LS + D  V V LSE++I  +I S+  +
Sbjct: 181 RLAQVDMEAPSGVEGMPGVIVPRKTVGELQKLLSEEVDEDVCVELSETKIRFSIGSVVFT 240

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP YQ VIP  NDK+L VN  +   AVDRVS +SS R +AVKL++   +L + 
Sbjct: 241 SKLIDGTFPEYQRVIPLGNDKKLIVNRQDFSSAVDRVSTISSDRGRAVKLTIEQGQLKLI 300

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V NPD G A + + V Y   P++I FN +YLL+I   +SS     DE+VF L  + +   
Sbjct: 301 VHNPDSGSAEDQLAVTYTSDPLEIGFNSRYLLDIAGQLSS-----DEMVFMLAEAGAPAL 355

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           IR       NN     +A YVLMP+R+
Sbjct: 356 IR-------NN--GVADALYVLMPIRV 373


>gi|298290590|ref|YP_003692529.1| DNA polymerase III subunit beta [Starkeya novella DSM 506]
 gi|296927101|gb|ADH87910.1| DNA polymerase III, beta subunit [Starkeya novella DSM 506]
          Length = 371

 Score =  313 bits (801), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 164/386 (42%), Positives = 232/386 (60%), Gaps = 16/386 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+TVER+++L+ L H  R++ER+NTIP+  +VL++ +   L ++A+  +IEI   I A 
Sbjct: 1   MKVTVERAELLKSLAHVHRVVERRNTIPILANVLMRTDARGLALRATDLDIEIVETIAAE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V   G+ TV AH +YDIVRKL +GAQ+      + GT + +  G S F LQ+ PE+EFP 
Sbjct: 61  VGQEGATTVPAHTIYDIVRKLPEGAQVQIETSGDRGT-LTVRAGRSRFALQTLPETEFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK-LCAVATDGH 179
               E  + F L +  LK LV++T FA++TEE RYYLNGI+ H+ +     L AVATDGH
Sbjct: 120 LAAGEMTHRFTLPAGELKRLVDKTQFAISTEETRYYLNGIYLHVADASGPVLRAVATDGH 179

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA A+    A    MP +IVPRKAV EI R+    ++ V V LS ++I ++++ + ++ 
Sbjct: 180 RLAQAQTTAPAGATGMPGVIVPRKAVAEIQRLAEDAEAEVTVELSTAKIRVSLDRVVLTS 239

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +LIDG FP+Y  VIP  NDK L V+  +   AVDRVS ++S R +AVKLS+   KL ++V
Sbjct: 240 KLIDGTFPDYGRVIPLGNDKTLVVDKADFASAVDRVSTVASERGRAVKLSIGDGKLTLSV 299

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
            NPD G A E + V Y   P+DI FN +YLL+I   I            +L    S   +
Sbjct: 300 TNPDSGSATEEIEVEYAAEPIDIGFNSRYLLDITSQIEG-----GTAELKLADPGSPTLV 354

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +  +K           A YVLMPMR+
Sbjct: 355 QDPEKR---------GALYVLMPMRV 371


>gi|49473789|ref|YP_031831.1| DNA polymerase III subunit beta [Bartonella quintana str. Toulouse]
 gi|49239292|emb|CAF25618.1| DNA polymerase III, beta chain [Bartonella quintana str. Toulouse]
          Length = 373

 Score =  313 bits (801), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 165/387 (42%), Positives = 251/387 (64%), Gaps = 16/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M +TV+R+ +L+ LG   R++ER+NT+P+  +VL+ A+   +++KA+  ++E+T +  A+
Sbjct: 1   MHVTVDRNQLLKSLGRVHRVVERRNTVPILSNVLIDADKNGVQLKATDLDLEVTESFMAN 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V   G+ITV AHLLYDIVRKL DG++I    +    + +++  G ++F LQ  P+ +FP 
Sbjct: 61  VKQAGAITVPAHLLYDIVRKLLDGSEIVLSVDMNQASTMSVVSGCAHFQLQCLPKVDFPE 120

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED-LKLCAVATDGH 179
           +   ++ Y F L++S LK+L++ T FA++TEE RYYLNGI+FH+ ++  LKL  VATDGH
Sbjct: 121 SLPGQFGYRFSLSASSLKHLLDCTQFAISTEETRYYLNGIYFHVVDDGVLKLRLVATDGH 180

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSK-DSSVKVSLSESRIHLNIESLSMS 238
           RLA  +++  + +  MP II+PRKAVGE+ ++LS + + +V V LSE++I  ++ S+  +
Sbjct: 181 RLAQVDMEAPSGVKDMPGIIIPRKAVGELQKLLSEEINDNVCVELSETKIRFSVGSVVFT 240

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP YQ VIP  NDK+L VN  N   AVDRVS +SS R +AVKL++   +L + 
Sbjct: 241 SKLIDGTFPEYQRVIPLGNDKKLIVNKQNFSSAVDRVSTISSDRGRAVKLTIEQGQLKLV 300

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V NPD G A + +   Y   P++I FN +YLL+I   +S      DE+VF L  + +   
Sbjct: 301 VHNPDSGSAEDQLAATYTSDPLEIGFNSRYLLDIAGQLSG-----DEMVFMLAEAGAPAL 355

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           IR  D           NA YVLMP+R+
Sbjct: 356 IRDND---------DANALYVLMPIRV 373


>gi|217979804|ref|YP_002363951.1| DNA polymerase III subunit beta [Methylocella silvestris BL2]
 gi|217505180|gb|ACK52589.1| DNA polymerase III, beta subunit [Methylocella silvestris BL2]
          Length = 372

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 163/387 (42%), Positives = 237/387 (61%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+T+ER+ +L+ LGH  R++ER+NTIP+  +VLL+A    L +KA+  ++E+T  + A 
Sbjct: 1   MKVTLERAALLKSLGHVHRVVERRNTIPILSNVLLRAEGKSLLLKATDLDLEVTERLAAD 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V V G  T+ AH LYDIVRKL DG+Q+S     + G ++ +  G S F LQ+ P+S+FP 
Sbjct: 61  VGVAGGTTLPAHTLYDIVRKLPDGSQVSLEIAGDSG-QLLLRSGRSRFNLQTLPDSDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK--LCAVATDG 178
               ++ + F L  + LK L+E+T FA++ EE RYYLNGIF H  E +    L AVATDG
Sbjct: 120 LAAGDFSHDFLLPPADLKRLIEKTQFAISNEETRYYLNGIFMHSMEAEGASVLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  E+      + MP +IVPRKAV E+ +++    + ++V LS ++       + ++
Sbjct: 180 HRLARVEIACPKGASGMPGVIVPRKAVTEVQKLIEDLSADIRVELSTTKARFTFGDVVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP  NDK L V       AVDRVS +SS R +AVKL+++  KL ++
Sbjct: 240 TKLIDGTFPDYMRVIPAGNDKRLIVERGPFAAAVDRVSTISSERGRAVKLAIADGKLTLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V NPD G A E ++V Y+  P+DI FN +YLL+I + + S     D  +F+L    S   
Sbjct: 300 VTNPDSGSAQEELDVDYDSTPLDIGFNARYLLDITEQLDS-----DTALFKLADPGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           ++ +D  S         A YVLMPMR+
Sbjct: 355 VQDRDGAS---------ALYVLMPMRV 372


>gi|121601944|ref|YP_989527.1| DNA polymerase III subunit beta [Bartonella bacilliformis KC583]
 gi|120614121|gb|ABM44722.1| DNA polymerase III, beta subunit [Bartonella bacilliformis KC583]
          Length = 373

 Score =  305 bits (782), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 165/387 (42%), Positives = 248/387 (64%), Gaps = 16/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T++R+  L+ LG   R++ER+NT+P+  +VL+ A+   + +KA+  ++EIT      
Sbjct: 1   MRVTIDRNQFLKSLGCVHRVVERRNTVPILSNVLIDADSDGMRLKATDLDLEITEFSVPH 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           ++  G ITV AHLLYDIVRKL DG +I    + +    +++  G +NF LQ FP+ +FP 
Sbjct: 61  IEQTGGITVPAHLLYDIVRKLPDGNEIILAVDADRPNTMSVISGFANFRLQGFPKMDFPE 120

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI-NEEDLKLCAVATDGH 179
           +   ++ + F L +S LK+L++ T FA++TEE RYYLNGI+FHI N+  LKL  VATDGH
Sbjct: 121 SLPGQFNFRFSLLASDLKHLLDCTQFAISTEETRYYLNGIYFHIVNDGALKLRLVATDGH 180

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSK-DSSVKVSLSESRIHLNIESLSMS 238
           RLA  +++  +    MP +I+PRK VGE+ R+LS + D+ V + LSE++I  ++ S+ ++
Sbjct: 181 RLAQVDMEAPSGSEGMPGVIIPRKTVGELQRLLSEEADNYVCIELSETKIRFSVGSVVLT 240

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP YQ VIP  NDK+L VN  +    VDRVS +SS R +AVKL++ + +L   
Sbjct: 241 SKLIDGTFPEYQRVIPLGNDKKLTVNRRDFSSTVDRVSTISSDRGRAVKLTIENGQLRFV 300

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A + +   Y   P++I FN +YLL+I   +S      DE+VF LD + +   
Sbjct: 301 VNNPDSGSAEDQLVADYASDPLEIGFNSRYLLDIAAQLSG-----DEIVFMLDEAGAPAL 355

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           IR    DS +      NA YVLMP+R+
Sbjct: 356 IR----DSHD-----TNALYVLMPIRV 373


>gi|163797311|ref|ZP_02191264.1| ApaG [alpha proteobacterium BAL199]
 gi|159177402|gb|EDP61958.1| ApaG [alpha proteobacterium BAL199]
          Length = 373

 Score =  305 bits (781), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 161/387 (41%), Positives = 242/387 (62%), Gaps = 16/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKIT++R+ +L+ L H   ++ER+NTIP+  +VLL+A DG L + A+  ++++  ++  S
Sbjct: 1   MKITIDRAALLKPLAHVQSVVERRNTIPILANVLLRAADGTLSLTATDMDLDVVESVGCS 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           VD  G  TV AH LY+IVRKLQDG+++      + G  + I  G SNF L + P  EFP+
Sbjct: 61  VDQPGQTTVPAHTLYEIVRKLQDGSEVELTAVGDSG-RMTIRAGRSNFSLPTLPMEEFPA 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFH-INEEDLK-LCAVATDG 178
              +    SF L+++  K L++RT FA++TEE RYYLNGIF H     D+  L AVATDG
Sbjct: 120 LSGDTLPTSFVLSAADAKTLIDRTRFAISTEETRYYLNGIFLHEAKAGDVAVLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  ++ +    A MP++IVPRKAV EI +++   D  V+VSLSE+++    ES  ++
Sbjct: 180 HRLARVQMPLPTGAAGMPAVIVPRKAVQEIRKLIEETDGDVQVSLSENKLRFAFESSVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y+ VIP  NDK LRV  +  ++AVDRV+ +S+ + ++VKLSL+S  L ++
Sbjct: 240 TKLIDGTFPDYERVIPTGNDKMLRVESSMFKRAVDRVATISTEKSRSVKLSLTSGTLTLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
            ++PD  +A E ++V Y    ++I FN +YL++I D I  DE    + VF +  + S   
Sbjct: 300 ANSPDNAQATEEVDVDYAAAAIEIGFNSRYLMDIADQI--DE--GSKAVFAMADAASPTV 355

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +  +  D            YVLMPMR+
Sbjct: 356 VTDESDD---------GTLYVLMPMRV 373


>gi|148251628|ref|YP_001236213.1| DNA polymerase III subunit beta [Bradyrhizobium sp. BTAi1]
 gi|146403801|gb|ABQ32307.1| DNA polymerase III, beta subunit [Bradyrhizobium sp. BTAi1]
          Length = 372

 Score =  305 bits (780), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 168/387 (43%), Positives = 243/387 (62%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+TVER+ +L+ LGH  R++ER+NTIP+  +VL++A +  L ++A+  ++E+T  + A 
Sbjct: 1   MKVTVERAQLLKSLGHVHRVVERRNTIPILGNVLVRAENARLSLRATDLDLEVTETLAAE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               G+ TV AH+ YDIVRKL DG+QI    + E    + I  G S F LQ+ PES+FP 
Sbjct: 61  TATAGATTVPAHMFYDIVRKLPDGSQIVLESDGERAV-LAIRAGRSKFTLQTLPESDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHIN--EEDLKLCAVATDG 178
               +  ++F + +  +K+L++RT FA++TEE RYYLNGI+ H     +   L AVATDG
Sbjct: 120 LAAGDMTHAFGVPAKDIKSLIDRTQFAISTEETRYYLNGIYLHAGGTAKQPSLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  ++   A  A+MP +IVPRK VGE+ R++   DS +++ LS+ +I   +  + ++
Sbjct: 180 HRLAQVDLPQPAGAAEMPGVIVPRKTVGEVQRLIEDNDSEIRIELSQGKIRFTLGQVVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP +NDKEL V+  +   AVDRVS +SS R +AVKL+LS  +L ++
Sbjct: 240 SKLIDGTFPDYGRVIPQNNDKELIVDKADFAAAVDRVSTISSERGRAVKLALSPGRLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V NPD G A E + V Y    +DI FN +YLL+I   I   EV     V RL    S   
Sbjct: 300 VTNPDSGSATEELEVEYAADALDIGFNSRYLLDIAAQIEG-EV----AVLRLADPGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           I+        ++DN+ NA YVLMPMR+
Sbjct: 355 IQ--------DRDNR-NALYVLMPMRV 372


>gi|312112797|ref|YP_004010393.1| DNA polymerase III subunit beta [Rhodomicrobium vannielii ATCC
           17100]
 gi|311217926|gb|ADP69294.1| DNA polymerase III, beta subunit [Rhodomicrobium vannielii ATCC
           17100]
          Length = 373

 Score =  300 bits (769), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 158/388 (40%), Positives = 237/388 (61%), Gaps = 18/388 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQAN-DGLLEIKASGPEIEITGAIPA 59
           M+  V+R+ +L  LGH   I+ER+NTIP+  ++L+ A+ DG L  KA+  ++E   A+PA
Sbjct: 1   MRFVVDRNAMLRALGHITGIVERRNTIPILSNILIGADRDGGLTFKATDLDMEAVEAVPA 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            V+V G++TV AH L+DIVRKL DGA+I   ++ E G  + ++ G ++F L   P  +FP
Sbjct: 61  KVEVTGAVTVPAHTLHDIVRKLPDGAEIRIERKGEEG-RLKVATGRASFELAILPADDFP 119

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATD 177
              + E    F + S  LK L E+  FA++TEE RYYLNGI+ H     E  KL AVATD
Sbjct: 120 DMGQTELPTRFTVDSGELKRLFEKARFAISTEETRYYLNGIYLHAVDGPEGGKLRAVATD 179

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLA  E    A    MP +IVPRKAVGE++++L S  + V+V+LS ++I   +  + +
Sbjct: 180 GHRLAQVETACPAGAGGMPGVIVPRKAVGEVIKLLESGAAPVEVTLSPAKIRFAVGDVVL 239

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +LIDG FP+Y  VIP +N K L +   +L +AVDRVS +SS + +AVKL+ +  +L +
Sbjct: 240 TSKLIDGSFPDYARVIPTTNKKLLLLENADLVKAVDRVSTLSSEKGRAVKLNAAEGRLVV 299

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           + +NP+ G A E ++  Y + P++I FN +YLL+I   I        + +F+L   +S  
Sbjct: 300 SANNPESGSATEEISAEYQDEPLEIGFNARYLLDITGQIDG-----TKALFKLADGSSPT 354

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            I         + +   +A YVLMPMR+
Sbjct: 355 LI---------SDETDASALYVLMPMRV 373


>gi|319407987|emb|CBI81641.1| DNA polymerase III, beta chain [Bartonella schoenbuchensis R1]
          Length = 373

 Score =  300 bits (767), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 161/387 (41%), Positives = 249/387 (64%), Gaps = 16/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M IT++R+  L+ L    R++ER+NTIP+  +VL+ A+   +++KA+  ++E+  +  A 
Sbjct: 1   MHITIDRNQFLKSLNRVHRVVERRNTIPILSNVLINASGDGVQLKATDLDLEVIESSLAK 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ITV AHLLYDIVRKL  G++I    +N     +++  G +NF LQ  P+ +FP 
Sbjct: 61  VEQEGAITVPAHLLYDIVRKLSSGSEIVLKVDNNQANTMSVVSGCANFQLQCLPKVDFPE 120

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED-LKLCAVATDGH 179
           +   ++   F L++S LK L + T FA++TEE RYYLNGI+FH+ ++  LKL  VATDGH
Sbjct: 121 SLPGQFSCCFSLSASDLKRLFDCTQFAISTEETRYYLNGIYFHVVDDGVLKLRLVATDGH 180

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSK-DSSVKVSLSESRIHLNIESLSMS 238
           RLA  +++  ++I  MP +I+PRKAVGE+ ++LS + +  V + LSE++I  ++ S+ ++
Sbjct: 181 RLAQVDMEAPSEIKDMPGVIIPRKAVGELQKLLSEETEGDVSIELSETKIRFSVGSVVLT 240

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP YQ VIP +NDK+L VN  +   AVDRVS +SS R +AVKL++ + +L + 
Sbjct: 241 SKLIDGTFPEYQRVIPLNNDKKLAVNRQDFSAAVDRVSTISSDRGRAVKLTIENGQLKLV 300

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A + +   Y   P++I FN +YLL+I   ++S     DE+VF L  + +   
Sbjct: 301 VNNPDSGSAEDQLVADYTSDPLEIGFNSRYLLDIAAQLTS-----DEMVFMLADAGAPAL 355

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           IR  D  +         A YVLMP+R+
Sbjct: 356 IRESDDAA---------ALYVLMPIRV 373


>gi|319405029|emb|CBI78639.1| DNA polymerase III, beta chain [Bartonella sp. AR 15-3]
          Length = 373

 Score =  299 bits (766), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 165/389 (42%), Positives = 250/389 (64%), Gaps = 20/389 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T+ RS +L+ LG   RI+ER+NTIP+  +VL+ A+DG +++KA+  ++EIT +   +
Sbjct: 1   MRVTISRSQLLKSLGRVHRIVERRNTIPILSNVLIDASDGRMQLKATDLDLEITESSSVN 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           ++  G+ITV AHLLYDIVRKL D +++    +    + ++I+ G +NF LQ  P+ +FP 
Sbjct: 61  IEQSGAITVPAHLLYDIVRKLLDDSEVILDVDESQASTMSITSGCTNFQLQCLPKVDFPE 120

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDL-KLCAVATDGH 179
           +   ++   F L +S LK L++ T FAM+TEE RYYLNGI+FHI  +D+ KL  V+TDGH
Sbjct: 121 SLPGQFSCRFSLLASKLKYLIDCTQFAMSTEETRYYLNGIYFHIISDDISKLRLVSTDGH 180

Query: 180 RLAVAEVDIVAQIAK--MPSIIVPRKAVGEILRILSSK-DSSVKVSLSESRIHLNIESLS 236
           RL  A+VDI A +    MP +I+PRK VGE+ ++L  + D+ V + LS+++I  ++ S+ 
Sbjct: 181 RL--AQVDIEAPLGSDGMPGVIIPRKTVGELQKLLGEEADNDVCIELSDTKIRFSVGSVI 238

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
           ++ +LIDG FP YQ VIP  NDK+L +N  +   AVDRVS +SS R +AVKL +    + 
Sbjct: 239 LTSKLIDGVFPEYQRVIPLKNDKKLIINRRDFSSAVDRVSTISSDRGRAVKLMIEKGLVR 298

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
             V+NPD G A + +   Y   P++I FN +YLL+I   +SS     DE++F    S + 
Sbjct: 299 FVVNNPDSGSAKDQLVADYAFDPLEIGFNSRYLLDIAAQLSS-----DEMIFTFADSGAP 353

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             IRG       N D   ++ YVLMP+R+
Sbjct: 354 TLIRG-------NSDT--DSLYVLMPIRV 373


>gi|154250460|ref|YP_001411284.1| DNA polymerase III subunit beta [Parvibaculum lavamentivorans DS-1]
 gi|154154410|gb|ABS61627.1| DNA polymerase III, beta subunit [Parvibaculum lavamentivorans
           DS-1]
          Length = 372

 Score =  299 bits (765), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 158/387 (40%), Positives = 232/387 (59%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKIT+ER  +L+ L H   ++ER+NTIP+  +VL++A DG L + A+  +IE+  AI A 
Sbjct: 1   MKITIERGALLKSLNHVQSVVERRNTIPILSNVLIKAEDGQLSLTATDLDIEVVEAIDAD 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V   G+ T SAH LYDIVRKL +GAQ+      + G  + ++ G S F LQS P+ +FP 
Sbjct: 61  VAQPGATTASAHTLYDIVRKLPEGAQVELSTGADEG-RLQLTAGRSRFALQSLPQEDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
                  + FEL +  ++ L+++T FA++ EE RYYLNGI+FH     +   L AVATDG
Sbjct: 120 MAAGSLPHRFELPAEAMRRLIDKTRFAISMEETRYYLNGIYFHAVDGPKQKSLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  + D+    A MP +IVPRK V E+ ++L     ++ V +SE++I      + ++
Sbjct: 180 HRLAQVDHDLPEGAAGMPGVIVPRKTVLELQKLLEGNSGALSVGVSETKIRFEFGGIVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP  NDK L+V+     +AVDRVS +S+ + +AVKL++   KL ++
Sbjct: 240 SKLIDGTFPDYGRVIPVGNDKMLQVDGKRFAEAVDRVSTISTEKSRAVKLNIEEGKLTLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V NPD G A E ++V Y+   ++I FN +YLL+I   +        E  F    S S   
Sbjct: 300 VTNPDSGSATEELSVSYSSPAIEIGFNARYLLDITGQLDG-----AEASFAFADSGSPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R    DS+++      A YVLMPMR+
Sbjct: 355 VR----DSEDSM-----AVYVLMPMRV 372


>gi|300021541|ref|YP_003754152.1| DNA polymerase III subunit beta [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299523362|gb|ADJ21831.1| DNA polymerase III, beta subunit [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 372

 Score =  299 bits (765), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 157/388 (40%), Positives = 237/388 (61%), Gaps = 19/388 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++ +ER ++L+ L H   ++ER+ TIP+  +++L+A+   L  KA+  E E++ ++ A 
Sbjct: 1   MRLEIERGELLKALSHVTSVVERRTTIPILSNIMLKASGETLMFKATDLEREVSESVGAK 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V   G++TV AH+L+DIVRKL DGA+I   ++ E    + I+ G S F LQ+    +FP 
Sbjct: 61  VSTPGTLTVPAHVLHDIVRKLPDGAEIEMKRDGE-KERLTITSGHSRFSLQTLSAEDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
               E  + F + +  LK L+++T FA++TEE RYYLNGIF H  E      L AVATDG
Sbjct: 120 LAVGEIGHEFTIEAGDLKRLIDKTRFAISTEETRYYLNGIFLHPAETAGVKTLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  E+ +      MP +IVPRK V E+ R+L    + V V +S++++   I  + ++
Sbjct: 180 HRLAQVELPLPKGAEGMPGVIVPRKTVHELARLLEDSSAKVNVGVSQTKVRFEIGPVVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP +NDKE++V   + + AVDRVS ++S R +AVKL+++ DKL +T
Sbjct: 240 SKLIDGTFPDYSRVIPHNNDKEMKVPNASFKSAVDRVSTIASERGRAVKLNVAKDKLILT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NP+ G A E + V Y+  P++I FN +YLL+I D + S     ++  F L    S   
Sbjct: 300 VNNPEGGSATEEIPVGYSAGPLEIGFNARYLLDIADQLES-----EDARFLLADPGSPTM 354

Query: 359 IR-GKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R G D           NA YVLMPMR+
Sbjct: 355 VRDGGDG----------NALYVLMPMRV 372


>gi|148555705|ref|YP_001263287.1| DNA polymerase III subunit beta [Sphingomonas wittichii RW1]
 gi|148500895|gb|ABQ69149.1| DNA polymerase III, beta subunit [Sphingomonas wittichii RW1]
          Length = 370

 Score =  298 bits (763), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 155/387 (40%), Positives = 238/387 (61%), Gaps = 19/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQAN-DGLLEIKASGPEIEITGAIPA 59
           MK T+ER+ +L+ LGH   ++ER+NTIP+  +VL++A  +G L + A+  +++I  A+PA
Sbjct: 1   MKATIERATLLKSLGHVQSVVERRNTIPILSNVLIEATAEGTLRLMATDLDLQIVEAVPA 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
           +VD  G+ TVSAH L+DI RKL +G+Q+          ++ +  G + F LQ+ P+ +FP
Sbjct: 61  AVDQPGATTVSAHTLFDIARKLPEGSQVQLSAAE---GKMQVVAGRARFNLQTLPKDDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK-LCAVATDG 178
              E E    FEL +  LK L+++T FA++TEE RYYLNGIFFH+ +E    L A ATDG
Sbjct: 118 MIAEGELPTRFELPAETLKQLIDKTRFAISTEETRYYLNGIFFHVQDEGSPVLKAAATDG 177

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA   +        MP II+PRK VGE+ ++L   D SV ++LS ++I   + +  ++
Sbjct: 178 HRLARVTIARPDGAEGMPDIIIPRKCVGELRKLLDEVDGSVDITLSSTKIRFGLGTAILT 237

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP +NDK L+++  +  + VDRV+ ++S + +AVK++L  DK+ ++
Sbjct: 238 SKLIDGTFPDYNRVIPTANDKLLKIDPKSFMEGVDRVATIASEKTRAVKMALDRDKITLS 297

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V +P+ G A E +   Y     +I FN +YLL+I+  I  D V   EV   L  + +   
Sbjct: 298 VTSPENGTAAEEVPGDYAATGFEIGFNARYLLDILGQIDGDTV---EV--HLADAAAPTL 352

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           IR         +++K  A YVLMPMR+
Sbjct: 353 IR---------ENDKAPALYVLMPMRV 370


>gi|84684520|ref|ZP_01012421.1| DNA polymerase III subunit beta [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84667499|gb|EAQ13968.1| DNA polymerase III subunit beta [Rhodobacterales bacterium
           HTCC2654]
          Length = 372

 Score =  298 bits (762), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 152/387 (39%), Positives = 237/387 (61%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKI+VER+ +L+ +G A  ++ER+NTIP+  +VL++A    +  +A+  +IE+    PA 
Sbjct: 1   MKISVERAVLLKAVGQAQSVVERRNTIPILANVLIEAEGSTVSFRATDLDIEVVDKAPAM 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TVSA  L++IVRKL DGA +    +   G  + +  G SNF L + P+ +FP 
Sbjct: 61  VERAGATTVSAVTLHEIVRKLPDGAMVQLTDDGAAG-RLTVEAGRSNFSLATLPKEDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK--LCAVATDG 178
               EY  +F   + VL+ L +++ FA++TEE RYYLNG++ H+++ +    L  VATDG
Sbjct: 120 MASSEYSANFSAPAPVLRRLFDKSKFAISTEETRYYLNGVYMHVSDAEGGKVLRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  + D+      MP +IVPRK VGE+ ++L   D  + VS+SE+++      ++++
Sbjct: 180 HRLARIDADLPKGAEDMPGVIVPRKTVGELRKLLDDDDMQIAVSVSETKVRFATPDITLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  N K++ V+     +AVDRV+ +SS R +AVKL+L+ DKL ++
Sbjct: 240 SKVIDGTFPDYTRVIPMGNTKKMEVDAAEFAKAVDRVATVSSERSRAVKLALAEDKLTLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V Y +  M+I FN KYLLEI     + +V  +  VF  D++   V 
Sbjct: 300 VNAPDAGAAEEELIVAYGDEGMEIGFNAKYLLEI-----ASQVDRENAVFMFDNAGQPVL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         + N  +A YV+MPMR+
Sbjct: 355 MR---------EGNDTSAVYVVMPMRV 372


>gi|319406518|emb|CBI80160.1| DNA polymerase III, beta chain [Bartonella sp. 1-1C]
          Length = 373

 Score =  296 bits (759), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 159/387 (41%), Positives = 246/387 (63%), Gaps = 16/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+IT+ RS +L+ L    RI+ER++ IP+  +VL+  +DG +++KA+  ++EI  +   +
Sbjct: 1   MRITIGRSQLLKSLSRVHRIVERRSAIPILSNVLIDTSDGRMQLKATDLDLEIIESSSVN 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           ++  G+ITV AHLLYDIVRKL D + +      +  + ++I+ G +NF LQ  P+ +FP 
Sbjct: 61  IEQGGAITVPAHLLYDIVRKLPDDSNVILEVNEDQASAMSITSGCTNFQLQCLPKVDFPE 120

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED-LKLCAVATDGH 179
           +   ++   F L +S LK L++ T FAM+TEE RYYLNGI+FH+ ++D LKL  V+TDGH
Sbjct: 121 SLPGQFSCRFSLLASRLKYLLDCTQFAMSTEETRYYLNGIYFHVIDDDILKLRLVSTDGH 180

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSK-DSSVKVSLSESRIHLNIESLSMS 238
           RLA  +++  + +  MP +I+PRK VGE+ ++L  + D+ V + LS+++I  ++ S+ ++
Sbjct: 181 RLAQVDIEAPSGVDGMPGVIIPRKTVGELQKLLGEEADNDVCIELSDTKIRFSVGSVILT 240

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP YQ VIP  NDK+L VN  +   AVDRVS +SS R +AVKL++    + + 
Sbjct: 241 SKLIDGVFPEYQRVIPLGNDKKLIVNRQDFSAAVDRVSTISSDRGRAVKLTIEKGVVKLV 300

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A + +   Y   P++I FN +YLL+I   +SS     DE++F    S +   
Sbjct: 301 VNNPDSGSAKDQLVANYVFDPLEIGFNSRYLLDIAAQLSS-----DEMIFMFADSGAPTL 355

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           IRG D           NA YVLMP+R+
Sbjct: 356 IRGNDDK---------NALYVLMPIRV 373


>gi|254461783|ref|ZP_05075199.1| DNA polymerase III, beta subunit [Rhodobacterales bacterium
           HTCC2083]
 gi|206678372|gb|EDZ42859.1| DNA polymerase III, beta subunit [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 372

 Score =  296 bits (759), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 153/387 (39%), Positives = 240/387 (62%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKI++ER+ +L+ + HA  ++ER+NTIP+  +VL++A    +  +A+  +IE+   + A 
Sbjct: 1   MKISIERATLLKAVSHAQSVVERRNTIPILANVLIEAEGNDVRFRATDLDIEVVDKVEAM 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TVSA  L +IVRKL DGAQ++   +   G  + I  G SNF L + P+ +FP 
Sbjct: 61  VERAGATTVSATTLNEIVRKLPDGAQVTLTDDGTSG-RLTIEAGRSNFSLATLPKEDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK--LCAVATDG 178
               EY  +F   +SVL+ L +++ FA++TEE RYYLNG++ HI++ +    L  VATDG
Sbjct: 120 MATSEYSANFSAQASVLRRLFDKSKFAISTEETRYYLNGVYMHISDAEGGKVLRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  + D+    ++MP +IVPRK VGE+ ++L   D  + VS+SE+++      ++++
Sbjct: 180 HRLARIDADLPENASEMPGVIVPRKTVGELRKLLDEDDMQIAVSVSETKVRFATPEITLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  N ++L V+  +  +AVDRV+ +SS R +AVKLSL  D+L ++
Sbjct: 240 SKVIDGTFPDYTRVIPQGNTRKLEVDAADFAKAVDRVATVSSERSRAVKLSLDEDRLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V Y +  ++I FN KYLLEI     + +V  +  VF  +SS     
Sbjct: 300 VNAPDSGAAEEELAVAYGDERLEIGFNAKYLLEI-----ASQVDRENAVFLFNSSGDPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         + N  +A YV+MPMR+
Sbjct: 355 MR---------EGNDTSAVYVVMPMRV 372


>gi|126724506|ref|ZP_01740349.1| DNA polymerase III subunit beta [Rhodobacterales bacterium
           HTCC2150]
 gi|126705670|gb|EBA04760.1| DNA polymerase III subunit beta [Rhodobacterales bacterium
           HTCC2150]
          Length = 372

 Score =  294 bits (752), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 153/387 (39%), Positives = 234/387 (60%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKI++ER+ +L+ +G A  ++ER+NTIP+  +VL++A+   +  +A+  +IE+     A 
Sbjct: 1   MKISIERATLLKAVGQAQSVVERRNTIPILANVLIEADANSVSFRATDLDIEVVDKTVAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           VD  G+ TVSA  L++IVRKL DGA +    +   G  + +  G SNF L + P  +FP 
Sbjct: 61  VDRPGATTVSAVTLHEIVRKLPDGALVQLTDDGSSG-RLTVEAGRSNFSLATLPREDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK--LCAVATDG 178
               EY  +F + S VL+ L +++ FA++TEE RYYLNG++ H+++ D    L  VATDG
Sbjct: 120 MANAEYGANFSIESKVLRRLFDKSKFAISTEETRYYLNGVYMHVSDADGGKVLRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  + D+ A    MP +IVPRK VGE+ ++L   D  + VS+SE+++      ++++
Sbjct: 180 HRLARIDADLPAGAETMPGVIVPRKTVGELRKLLDDDDVKIAVSVSETKVRFATPEITLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  N + L V+     +AVDRV+ +SS R +AVKLSL  D+L ++
Sbjct: 240 SKVIDGTFPDYTRVIPQGNTRRLEVDAAEFAKAVDRVATVSSERSRAVKLSLDEDRLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V Y +  ++I FN KYLLEI     + +V  +  VF  +SS     
Sbjct: 300 VNAPDSGAAEEELAVAYGDDRLEIGFNAKYLLEI-----ASQVDRENAVFMFNSSGDPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         + N   A YV+MPMR+
Sbjct: 355 MR---------EGNDTTAVYVVMPMRV 372


>gi|149202936|ref|ZP_01879907.1| DNA polymerase III subunit beta [Roseovarius sp. TM1035]
 gi|149143482|gb|EDM31518.1| DNA polymerase III subunit beta [Roseovarius sp. TM1035]
          Length = 372

 Score =  292 bits (748), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 149/387 (38%), Positives = 235/387 (60%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+++ER  +L+ +  A  ++ER+NTIP+  +VL++A    ++ +A+  +IE+    PA 
Sbjct: 1   MKLSIERGALLKAVSQAQSVVERRNTIPILANVLIEAEGNSVQFRATDLDIEVVDKAPAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TVSA +L++IVRKL DG+ ++   +   G  + +  G SNF L + P+ +FP 
Sbjct: 61  VERAGATTVSAVMLHEIVRKLPDGSLVTLSDDGASG-RLTVQAGRSNFNLATLPKEDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK--LCAVATDG 178
               EY  +F   + VL+ L +++ FA++TEE RYYLNG++ H+++ D    L  VATDG
Sbjct: 120 MASSEYASNFSAPAPVLRRLFDKSKFAISTEETRYYLNGVYLHVSDADGGKVLRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  + D+    + MP +IVPRK VGE+ ++L   D  + VS+SE++I      ++++
Sbjct: 180 HRLARIDADLPDGASDMPGVIVPRKTVGELRKLLEDDDMKIAVSVSETKIRFATPDITLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  N + + V+     QAVDRV+ +SS R +AVKLSL  D+L ++
Sbjct: 240 SKVIDGTFPDYTRVIPQGNTRRMEVDAAEFAQAVDRVATVSSERSRAVKLSLDEDRLILS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V Y +  ++I FN KYLLEI     + +V  +  VF  +SS     
Sbjct: 300 VNAPDSGAAEEELAVAYGDERLEIGFNAKYLLEI-----ASQVDRENAVFLFNSSGDPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         + N   A YV+MPMR+
Sbjct: 355 MR---------EGNDTTAVYVVMPMRV 372


>gi|85705684|ref|ZP_01036781.1| DNA polymerase III subunit beta [Roseovarius sp. 217]
 gi|85669674|gb|EAQ24538.1| DNA polymerase III subunit beta [Roseovarius sp. 217]
          Length = 372

 Score =  292 bits (748), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 149/387 (38%), Positives = 235/387 (60%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+++ER  +L+ +  A  ++ER+NTIP+  +VL++A    ++ +A+  +IE+    PA 
Sbjct: 1   MKLSIERGALLKAVSQAQSVVERRNTIPILANVLIEAEGNSVQFRATDLDIEVVDKAPAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TVSA +L++IVRKL DG+ ++   +   G  + +  G SNF L + P+ +FP 
Sbjct: 61  VERAGATTVSAVMLHEIVRKLPDGSLVTLSDDGTSG-RLTVQAGRSNFNLATLPKEDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK--LCAVATDG 178
               EY  +F   + VL+ L +++ FA++TEE RYYLNG++ H+++ D    L  VATDG
Sbjct: 120 MASSEYASNFSAPAPVLRRLFDKSKFAISTEETRYYLNGVYLHVSDADGGKVLRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  + D+    + MP +IVPRK VGE+ ++L   D  + VS+SE++I      ++++
Sbjct: 180 HRLARIDADLPDGASDMPGVIVPRKTVGELRKLLEDDDMKIAVSVSETKIRFATPDITLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  N + + V+     QAVDRV+ +SS R +AVKLSL  D+L ++
Sbjct: 240 SKVIDGTFPDYTRVIPQGNTRRMEVDAAEFAQAVDRVATVSSERSRAVKLSLDEDRLILS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V Y +  ++I FN KYLLEI     + +V  +  VF  +SS     
Sbjct: 300 VNAPDSGAAEEELAVAYGDERLEIGFNAKYLLEI-----ASQVDRENAVFLFNSSGDPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         + N   A YV+MPMR+
Sbjct: 355 MR---------EGNDTTAVYVVMPMRV 372


>gi|114762141|ref|ZP_01441609.1| DNA polymerase III subunit beta [Pelagibaca bermudensis HTCC2601]
 gi|114545165|gb|EAU48168.1| DNA polymerase III subunit beta [Roseovarius sp. HTCC2601]
          Length = 372

 Score =  292 bits (748), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 150/388 (38%), Positives = 234/388 (60%), Gaps = 19/388 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+++ER+ +L+ +  A  ++ER+NTIP+  +VL++A    +  +A+  +IE+    PA 
Sbjct: 1   MKVSIERATLLKAVSQAQSVVERRNTIPILANVLIEAEGDTVTFRATDLDIEVLDRAPAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TVSA  L++IVRKL DGA +    ++  G  + ++ G SNF L + P+ +FP 
Sbjct: 61  VERAGATTVSAVTLHEIVRKLPDGALVQLADDSAAG-RLTVTAGRSNFNLATLPKEDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHIN--EEDLKLCAVATDG 178
               EY  +F   +  L+ L +++ FA++TEE RYYLNG++ H++  EE   L  VATDG
Sbjct: 120 MASSEYATNFSAKAETLRKLFDKSKFAISTEETRYYLNGVYMHVSDSEEGRVLRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  +  +      MP +IVPRK VGE+ ++L   D  + VS+SE+++      ++++
Sbjct: 180 HRLARIDAPVPEGAEAMPGVIVPRKTVGELRKLLDDDDMDIAVSVSETKVRFATPDITLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  N + L V+ T   +AVDRV+ +SS R +AVKL L  D+L ++
Sbjct: 240 SKVIDGTFPDYSRVIPTGNTRRLEVDATEFAKAVDRVATVSSERSRAVKLQLDEDRLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V Y + P++I FN KYLLEI     + +V  +  VF  +SS     
Sbjct: 300 VNAPDSGAAEEELAVAYGDEPLEIGFNAKYLLEI-----ASQVDRENAVFMFNSSGDPTL 354

Query: 359 IR-GKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R G D           +A YV+MPMR+
Sbjct: 355 MREGSD----------TSAVYVVMPMRV 372


>gi|260428831|ref|ZP_05782808.1| DNA polymerase III, beta subunit [Citreicella sp. SE45]
 gi|260419454|gb|EEX12707.1| DNA polymerase III, beta subunit [Citreicella sp. SE45]
          Length = 372

 Score =  292 bits (747), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 150/388 (38%), Positives = 236/388 (60%), Gaps = 19/388 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+++ER+ +L+ +  A  ++ER+NTIP+  +VL++A    +  +A+  +IE+    PA 
Sbjct: 1   MKVSIERATLLKAVSQAQSVVERRNTIPILANVLIEAEGNTVTFRATDLDIEVLDKAPAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TVSA  L++IVRKL DGA +   ++   G  + ++ G SNF L + P+ +FP 
Sbjct: 61  VERAGATTVSAVTLHEIVRKLPDGALVQLSEDGGAG-RLTVTAGRSNFNLATLPKEDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
               EY  +F   + VL+ L +++ FA++TEE RYYLNG++ HI  +EE   L  VATDG
Sbjct: 120 MASSEYATNFTAKAEVLRKLFDKSKFAISTEETRYYLNGVYMHIADSEEGRVLRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  +  + +    MP +IVPRK VGE+ ++L   +  + VS+SE+++      ++++
Sbjct: 180 HRLARIDAPLPSGAEAMPGVIVPRKTVGELRKLLDEDEMDIAVSVSETKVRFATPDITLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  N + L V+ +   +AVDRV+ +SS R +AVKL L  D+L ++
Sbjct: 240 SKVIDGTFPDYSRVIPTGNTRRLEVDASEFAKAVDRVATVSSERSRAVKLQLDEDRLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V Y + P++I FN KYLLEI     + +V  +  VF  +SS     
Sbjct: 300 VNAPDSGAAEEELAVAYGDDPLEIGFNAKYLLEI-----ASQVDRENAVFMFNSSGDPTL 354

Query: 359 IR-GKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R G D           +A YV+MPMR+
Sbjct: 355 MREGSD----------TSAVYVVMPMRV 372


>gi|83944867|ref|ZP_00957233.1| DNA polymerase III subunit beta [Oceanicaulis alexandrii HTCC2633]
 gi|83851649|gb|EAP89504.1| DNA polymerase III subunit beta [Oceanicaulis alexandrii HTCC2633]
          Length = 372

 Score =  291 bits (745), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 159/391 (40%), Positives = 235/391 (60%), Gaps = 25/391 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+T+ER+ +L+ LGH   ++ER+NTIP+  +VL+ A+DG     A+  ++EI     AS
Sbjct: 1   MKLTIERAILLKALGHVQAVVERRNTIPILSNVLINASDGFARFTATDLDMEIVEEAEAS 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTE---VNISHGDSNFYLQSFPESE 117
           V+  G IT  AH LY+I RKL +G+Q++     ELG +   + +S G S F L   P  +
Sbjct: 61  VEREGLITAPAHTLYEIARKLPEGSQVTL----ELGGDDPRILLSAGRSRFNLPILPPGD 116

Query: 118 FPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK--LCAVA 175
           FP    E+   SF   +S +  L+++T FA++TEE RYYLNGI  H  E D +  L AVA
Sbjct: 117 FPVMPSEDLAVSFTAPASEIARLIDKTKFAISTEETRYYLNGIHLHAAERDGRKTLRAVA 176

Query: 176 TDGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESL 235
           TDGHRLA+AE D+      MP++IVPRK + E+ R+L   D  V VS+SE +I   + + 
Sbjct: 177 TDGHRLALAETDLPDGAMGMPAVIVPRKPIQELRRLLEDLDGDVDVSVSEGKIRFQLGAA 236

Query: 236 SMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKL 295
            ++ +LIDG FP+Y+ VIP  NDK +R++     QAVDRV+ +S  + ++VKLSL+  ++
Sbjct: 237 VLTSKLIDGTFPDYERVIPRGNDKVMRIDRAPFAQAVDRVATISQEKSRSVKLSLAPGQV 296

Query: 296 CMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRL-DSSN 354
            +TV+NP+ G A E +   Y+   M I FN +YLL++   I       DE +F L DS +
Sbjct: 297 TLTVNNPESGAASEELVADYSADEMTIGFNARYLLDVASQIEG-----DEAIFELADSGS 351

Query: 355 SSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            +      DKD++          YVLMP+R+
Sbjct: 352 PTRVTDSGDKDAE----------YVLMPLRV 372


>gi|110677617|ref|YP_680624.1| DNA polymerase III subunit beta [Roseobacter denitrificans OCh 114]
 gi|109453733|gb|ABG29938.1| DNA polymerase III, beta subunit [Roseobacter denitrificans OCh
           114]
          Length = 372

 Score =  291 bits (744), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 148/387 (38%), Positives = 240/387 (62%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKI++ER+ +L+ +  A  ++ER+NTIP+  +VL++A    +  +A+  +IE+    PA 
Sbjct: 1   MKISIERAALLKAVSQAQSVVERRNTIPILANVLIEAEGSDVTFRATDLDIEVVDKAPAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TVSA  L++IVRKL DGA ++   ++ +G  + +  G SNF L + P+ +FP 
Sbjct: 61  VERAGATTVSATTLHEIVRKLPDGALVTLTADSAIG-RLTVEAGRSNFSLATLPKEDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK--LCAVATDG 178
               EY  +F + + VL+ L +++ FA++TEE RYYLNG++ H+ + D    L  VATDG
Sbjct: 120 MATSEYQSNFSVKAPVLRRLFDKSKFAISTEETRYYLNGVYMHVADADGGHVLRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  + D+      MP +IVPRK VGE+ ++L + + ++ VS+SE+++      ++++
Sbjct: 180 HRLARIDADLPEAANDMPGVIVPRKTVGELRKLLDNDEMTIAVSVSETKVRFATPDITLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  N ++L V+  +  +AVDRV+ +SS R +AVKL L  D+L ++
Sbjct: 240 SKVIDGTFPDYTRVIPQGNTRKLEVDAADFARAVDRVATVSSERSRAVKLQLDEDRLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V Y +  ++I FN KYLLEI     + +V  +  VF  +SS     
Sbjct: 300 VNAPDSGAAEEELAVAYGDERLEIGFNAKYLLEI-----ASQVDRENAVFLFNSSGDPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         + N ++A YV+MPMR+
Sbjct: 355 MR---------EGNDLSAVYVVMPMRV 372


>gi|294085124|ref|YP_003551884.1| DNA polymerase III subunit beta [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664699|gb|ADE39800.1| DNA polymerase III, beta subunit [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 367

 Score =  289 bits (740), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 152/386 (39%), Positives = 237/386 (61%), Gaps = 20/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+ ++R  +L  LGH   ++ER+NTIP+  +V+L+A DG L + A+  +++IT  +  +
Sbjct: 1   MKLAIDRMSLLRPLGHVQSVVERRNTIPILANVVLRAEDGQLSLTATDMDMDITTEVGCA 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELG-TEVNISHGDSNFYLQSFPESEFP 119
           V   G+ T+SAH+LYDIVRKL DG+++    E  +G     IS G S+F L + P  +FP
Sbjct: 61  VATAGTTTMSAHMLYDIVRKLPDGSEV----ELSVGDGHAMISAGRSSFRLPTLPVEDFP 116

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +    E   +F L ++  ++L++ T FA++TEE RYYLNGI+ H ++    LCAVATDGH
Sbjct: 117 AISSNELPTNFVLTAADFRDLIDATKFAISTEETRYYLNGIYLHKSDAG-DLCAVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA+ +  +    A+MPSII+PRKAVGE+ ++L   D  V +S+SE+R      ++ ++ 
Sbjct: 176 RLAMTKQTLPGGAAQMPSIILPRKAVGELRKLLDDYDGDVTISMSETRAEFAFGAVRLTT 235

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +LIDG FP+Y  VIP +NDK ++V+      AVDRVS +SS + ++VK+ L +  + ++ 
Sbjct: 236 KLIDGTFPDYTRVIPTNNDKIMQVDVGAFSAAVDRVSTISSEKSKSVKIGLRAGVMTLSA 295

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
            N D   A E + V Y+   M+I FN +YLL+I   ++S E+V+    F L    S   +
Sbjct: 296 SNTDASSATEELEVSYSGNEMEIGFNARYLLDIASQVNS-EMVE----FALADQGSPTLV 350

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           R    D+         + +VLMPMR+
Sbjct: 351 RTPGDDA---------SLFVLMPMRV 367


>gi|260574426|ref|ZP_05842430.1| DNA polymerase III, beta subunit [Rhodobacter sp. SW2]
 gi|259023322|gb|EEW26614.1| DNA polymerase III, beta subunit [Rhodobacter sp. SW2]
          Length = 372

 Score =  289 bits (739), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 150/387 (38%), Positives = 234/387 (60%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKI++ER  +L+ L  A  ++ER+NTIP+  +VL++A    +  +A+  +IE+    PA 
Sbjct: 1   MKISIERGTLLKALSQAQSVVERRNTIPILANVLIEAEGANVSFRATDLDIEVVDRAPAM 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TVSA +L++IVRKL +GA +S  ++   G  + I+ G S F L + P+ +FP 
Sbjct: 61  VERAGATTVSAVMLHEIVRKLPEGALVSLAEDGAAG-RLTITAGRSTFNLATLPKEDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHIN--EEDLKLCAVATDG 178
               EY  +F   + +L+ L ++  FA++TEE RYYLNG++ H++  E    L AVATDG
Sbjct: 120 MANAEYASNFSAPAPLLRRLFDKAKFAISTEETRYYLNGVYLHVSTGESGPVLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  +  +    A MP +IVPRK V E+ ++L   ++ + VS+SE+++      L+++
Sbjct: 180 HRLARIDAPLPEGAAGMPGVIVPRKTVNELRKLLDDDEAQIAVSVSETKVRFATPVLTLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  N + L V+     +AVDRV+ +SS R +AVKLSL  D+L ++
Sbjct: 240 SKVIDGTFPDYTRVIPTGNTRRLEVDAAEFARAVDRVATVSSERSRAVKLSLDEDRLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V Y +  ++I FN KYLLEI     + +V  +  VF  +SS     
Sbjct: 300 VNAPDSGAAEEELAVAYGDERLEIGFNAKYLLEI-----ASQVDRENAVFLFNSSGDPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         + N  +A YV+MPMR+
Sbjct: 355 MR---------EGNDTSAVYVVMPMRV 372


>gi|56695075|ref|YP_165422.1| DNA polymerase III subunit beta [Ruegeria pomeroyi DSS-3]
 gi|56676812|gb|AAV93478.1| DNA polymerase III, beta subunit [Ruegeria pomeroyi DSS-3]
          Length = 372

 Score =  288 bits (738), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 149/387 (38%), Positives = 235/387 (60%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKI++ER  +L+ +  A  ++ER+NTIP+  +VL++A     + +A+  +IE+    PA 
Sbjct: 1   MKISIERGALLKAVAQAQSVVERRNTIPILANVLIEAEGEGAQFRATDLDIEVVDKAPAM 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           ++  G+ TVSA  L++IVRKL DGA ++   +   G  + +  G SNF L + P  +FP 
Sbjct: 61  IERAGATTVSATTLHEIVRKLPDGALVTLTADAAAG-RLTVEAGRSNFSLATLPREDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK--LCAVATDG 178
               EY  +F   ++VL+ L +++ FA++TEE RYYLNG++ H+ + D    L  VATDG
Sbjct: 120 MASSEYQSNFTANAAVLRRLFDKSKFAISTEETRYYLNGVYMHVADGDGGKVLRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  + D+ A    MP +IVPRK VGE+ ++L   +  + VS+SE+++      ++++
Sbjct: 180 HRLARIDADLPAGATDMPGVIVPRKTVGELRKLLDDDEMDIAVSVSETKVRFATPDITLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP +N + L V+ +   +AVDRV+ +SS R +AVKL L  DKL ++
Sbjct: 240 SKVIDGTFPDYTRVIPQANTRRLEVDASEFAKAVDRVATVSSERSRAVKLQLDEDKLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V Y++  ++I FN KYLLEI     + +V  +  VF  +SS     
Sbjct: 300 VNAPDSGAAEEELAVAYSDERLEIGFNAKYLLEI-----ASQVDRENAVFLFNSSGDPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         + N  +A YV+MPMR+
Sbjct: 355 MR---------EGNDQSAVYVVMPMRV 372


>gi|332187226|ref|ZP_08388965.1| DNA polymerase III, beta subunit [Sphingomonas sp. S17]
 gi|332012647|gb|EGI54713.1| DNA polymerase III, beta subunit [Sphingomonas sp. S17]
          Length = 380

 Score =  288 bits (738), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 156/388 (40%), Positives = 234/388 (60%), Gaps = 20/388 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQAN-DGLLEIKASGPEIEITGAIPA 59
           MK T+ER+ +L+ L H   ++ER+NTIP+  +VLL+A  +G L + A+  +++I  ++ A
Sbjct: 10  MKATIERATLLKGLSHVQSVVERRNTIPILSNVLLEATAEGQLRMMATDLDLQINDSVAA 69

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
           +VD  GS TVSAH L+DI RKL +GAQ+           + I  G + F L + P  +FP
Sbjct: 70  AVDQPGSTTVSAHTLFDIARKLPEGAQVQLTAAE---GRMTIVAGRARFSLGTLPRDDFP 126

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK--LCAVATD 177
              E E    FEL   +LK ++++T FA++TEE RYYLNGIF H+ E++    L A ATD
Sbjct: 127 VIAEGELPTQFELPVELLKQIIDKTRFAISTEETRYYLNGIFLHVAEDNGAPVLKAAATD 186

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLA   ++       MP +IVPRK V E+ ++L   D SV VSLS ++I  ++    +
Sbjct: 187 GHRLARVTIERPNGAEGMPDVIVPRKCVAELRKLLDEVDGSVGVSLSGTKIRFDLGQAIL 246

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +LIDG FP+Y  VIP +NDK L+++     Q VDRVS +++ + +AVK++L  D++ +
Sbjct: 247 TSKLIDGTFPDYSRVIPTANDKILKLDPKAFMQGVDRVSTIATEKTRAVKMALDRDRITL 306

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           +V +P+ G A E +   Y   P +I FN +YLL+I+  I SD V   EV   L  + +  
Sbjct: 307 SVTSPENGTASEEVPGEYTSLPFEIGFNSRYLLDILGQIDSDLV---EV--HLADAAAPT 361

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            IR         +++K  A YVLMPMR+
Sbjct: 362 LIR---------ENDKAPALYVLMPMRV 380


>gi|84501259|ref|ZP_00999464.1| DNA polymerase III subunit beta [Oceanicola batsensis HTCC2597]
 gi|84390550|gb|EAQ03038.1| DNA polymerase III subunit beta [Oceanicola batsensis HTCC2597]
          Length = 372

 Score =  288 bits (738), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 150/388 (38%), Positives = 241/388 (62%), Gaps = 19/388 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK ++ER+ +L+ +  A  ++ER+NTIP+  +VL++A    ++ +A+  +IE+    PA 
Sbjct: 1   MKFSIERAALLKAVSQAQSVVERRNTIPILANVLIEAEGNEVQFRATDLDIEVVDKAPAM 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TVSA  L++IVRKL DGAQ++  ++   G  + ++ G SNF L + P+ +FP 
Sbjct: 61  VERAGATTVSAVTLHEIVRKLPDGAQVTLSEDGAAG-RLTVAAGRSNFNLATLPKEDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINE-EDLK-LCAVATDG 178
               EY  +F   + VL+ L +++ FA++TEE RYYLNG++ H+ E ED + L  VATDG
Sbjct: 120 MASSEYQSNFSAPAPVLRRLFDKSKFAISTEETRYYLNGVYMHVAEGEDGRMLRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  +  +    A MP +IVPRK VGE+ ++L   +  V VS+SE+++      ++++
Sbjct: 180 HRLARIDATLPEGAADMPGVIVPRKTVGELRKLLDDDELQVAVSVSETKVRFATPEITLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  N +++ V+ ++  +AVDRV+ +SS R +AVKL+L  D+L ++
Sbjct: 240 SKVIDGTFPDYTRVIPQGNTRKMEVDASDFAKAVDRVATVSSERSRAVKLALDEDRLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V Y +  ++I FN KYLLEI     + +V  +  VF  +S+     
Sbjct: 300 VNAPDSGAAEEELAVAYGDERLEIGFNAKYLLEI-----ASQVDRENAVFLFNSAGDPTL 354

Query: 359 IR-GKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R G D           +A YV+MPMR+
Sbjct: 355 MREGSD----------TSAVYVVMPMRV 372


>gi|83950589|ref|ZP_00959322.1| DNA polymerase III subunit beta [Roseovarius nubinhibens ISM]
 gi|83838488|gb|EAP77784.1| DNA polymerase III subunit beta [Roseovarius nubinhibens ISM]
          Length = 372

 Score =  288 bits (737), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 148/387 (38%), Positives = 234/387 (60%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK ++ER  +L+ +  A  ++ER+NTIP+  +VL++A    ++ +A+  +IE+    PA 
Sbjct: 1   MKFSIERGILLKAVSQAQSVVERRNTIPILANVLIEAEGDTVQFRATDLDIEVVDKAPAK 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  GS TVSA  L++IVRKL DGA ++   +   G  + +  G S+F L + P+ +FP 
Sbjct: 61  VERAGSTTVSAVTLHEIVRKLPDGALVTLTDDGAAG-RLAVEAGRSSFNLATLPKEDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK--LCAVATDG 178
               EY  +F   + VL+ L +++ FA++TEE RYYLNG++ H+++ D    L  VATDG
Sbjct: 120 MASSEYASNFSAKAPVLRRLFDKSKFAISTEETRYYLNGVYMHVSDGDGGKVLRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  + D+      MP +IVPRK VGE+ ++L   D+ + VS+SE+++      ++++
Sbjct: 180 HRLARIDADLPDGAGDMPGVIVPRKTVGELRKLLDDDDAVIAVSVSETKVRFATPEITLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  N + L V+     +AVDRV+ +SS R +AVKL+L  D+L ++
Sbjct: 240 SKVIDGTFPDYTRVIPQGNTRRLEVDAAEFAKAVDRVATVSSERSRAVKLALDEDRLILS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V Y +  ++I FN KYLLEI     + +V  +  VF  +SS     
Sbjct: 300 VNAPDSGAAEEELAVAYGDERLEIGFNAKYLLEI-----ASQVDRENAVFMFNSSGDPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         + N  +A YV+MPMR+
Sbjct: 355 MR---------EGNDTSAVYVVMPMRV 372


>gi|319403602|emb|CBI77187.1| DNA polymerase III, beta chain [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 373

 Score =  288 bits (736), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 160/388 (41%), Positives = 244/388 (62%), Gaps = 18/388 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T+ RS +L+ L    RI+ER+NTIP+  +VL+  +DG +++KA+  ++EI      +
Sbjct: 1   MRVTIGRSQLLKSLSRVHRIVERRNTIPILSNVLIDTSDGRMQLKATDLDLEIIETSSVN 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESEFP 119
           ++  G+ITV AHLLYDIVRKL D + +     EN+  T ++I+ G +NF LQ  P+ +FP
Sbjct: 61  LEQAGAITVPAHLLYDIVRKLPDDSDVILDVNENQAST-MSITSGCTNFQLQCLPKVDFP 119

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED-LKLCAVATDG 178
            +   ++   F L +S LK L++ T FAM+TEE RYYLNGI+FH+  +D LKL  V+TDG
Sbjct: 120 ESLPGQFSCRFSLLASRLKYLLDCTQFAMSTEETRYYLNGIYFHVIYDDILKLRLVSTDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSK-DSSVKVSLSESRIHLNIESLSM 237
           HRLA  +++  +    MP +I+PRK VGE+ ++L  + D+ V + LS+++I  ++ S+ +
Sbjct: 180 HRLAQVDIEAPSGADGMPGVIIPRKTVGELQKLLGEEADNDVCIELSDTKIRFSVGSVIL 239

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +LIDG FP YQ VIP  NDK+L +N  +   AVDRVS +SS R +AVKL +    + +
Sbjct: 240 TSKLIDGVFPEYQRVIPLGNDKKLIINRQDFSAAVDRVSTISSDRGRAVKLMIEKGIVKL 299

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
            V+NPD G A + +   Y   P++I FN +YLL+I   +SS     DE++     S +  
Sbjct: 300 VVNNPDSGSAKDQLVADYVFDPLEIGFNSRYLLDIAAQLSS-----DEMICMFADSAAPT 354

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            IRG         +   NA YVLMP+R+
Sbjct: 355 LIRG---------NGDTNALYVLMPVRV 373


>gi|294010896|ref|YP_003544356.1| DNA polymerase III beta subunit [Sphingobium japonicum UT26S]
 gi|292674226|dbj|BAI95744.1| DNA polymerase III beta subunit [Sphingobium japonicum UT26S]
          Length = 370

 Score =  288 bits (736), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 150/387 (38%), Positives = 238/387 (61%), Gaps = 19/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQAN-DGLLEIKASGPEIEITGAIPA 59
           MK T+ER+ +L+ L H   ++ER+NTIP+  +VL++A+ DG +++ A+  +++I  ++ A
Sbjct: 1   MKATIERATLLKSLSHVQSVVERRNTIPILSNVLIEASADGAIKLMATDLDLQIVESVSA 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            V+  G+ T+SAH L+DI RKL +G+Q+S         ++ I  G + F L + P  +FP
Sbjct: 61  QVEQPGATTISAHTLFDIARKLPEGSQVSLHAAE---GKMLIQAGRARFNLSTLPRDDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK-LCAVATDG 178
              E +   SFEL +  LK ++++T FA++TEE RYYLNGI+FH++++    L A ATDG
Sbjct: 118 VIAEGDLPTSFELPAETLKQIIDKTRFAISTEETRYYLNGIYFHVSDDGQPVLKAAATDG 177

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA   V        MP IIVPRK +GE+ ++L   D SV++SLS S+I   + S  ++
Sbjct: 178 HRLARVTVPRPDGADGMPGIIVPRKCIGELRKLLDEVDGSVQISLSASKIRFGLGSAILT 237

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP +NDK L+++  +  + VDRV+ +++ + +AVK++L  DK+ ++
Sbjct: 238 SKLIDGTFPDYSRVIPTANDKLLKIDPRSFEEGVDRVATIATEKTRAVKMTLDRDKITLS 297

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V +P+ G A E +   +     DI FN +YLL+I+  I S     D V   L  + +   
Sbjct: 298 VTSPENGTAAEEVPGAFQGEGFDIGFNARYLLDILGQIDS-----DLVELHLADAAAPTL 352

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           IR         +D++  A YVLMPMR+
Sbjct: 353 IR---------EDDRSPALYVLMPMRV 370


>gi|221640842|ref|YP_002527104.1| DNA polymerase III subunit beta [Rhodobacter sphaeroides KD131]
 gi|221161623|gb|ACM02603.1| DNA polymerase III, beta subunit [Rhodobacter sphaeroides KD131]
          Length = 372

 Score =  287 bits (735), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 150/387 (38%), Positives = 233/387 (60%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKI++ER  +L+ +G A  ++ER+NTIP+  +VL++A    +  +A+  +IE+    PA 
Sbjct: 1   MKISIERGALLKAVGQAQSVVERRNTIPILANVLIEAEGDTVSFRATDLDIEVVDRTPAV 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TVSA +L++IVRKL DGA +    E+     + ++ G S F L + P+ +FP 
Sbjct: 61  VERAGATTVSAVMLHEIVRKLPDGALVGL-SEDPASGRLTVTAGRSVFSLATLPKEDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
               EY  +F+  + VL+ L ++  FA++TEE RYYLNG+F H+   EE   L  VATDG
Sbjct: 120 MASSEYSSTFKAPAPVLRRLFDKAKFAISTEETRYYLNGVFMHVATGEEGPVLRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  +  +      MP +IVPRK V E+ ++L   +  + VS+SE+++      ++M+
Sbjct: 180 HRLARIDAALPEGAQGMPGVIVPRKTVNELRKLLDDDEVEIAVSVSETKVRFATPQITMT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP +N + L V+     +AVDRV+ +SS R +AVKLSL  D+L ++
Sbjct: 240 SKVIDGTFPDYSRVIPTANARRLEVDAQEFAKAVDRVATVSSERSRAVKLSLDEDRLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V Y +  ++I FN KYLLEI     + +V  +  VF  +SS     
Sbjct: 300 VNAPDSGAAEEELAVAYGDERLEIGFNAKYLLEI-----ASQVDRENAVFLFNSSGDPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         + N ++A YV+MPMR+
Sbjct: 355 MR---------EGNDMSAVYVVMPMRV 372


>gi|83309736|ref|YP_420000.1| DNA polymerase III subunit beta [Magnetospirillum magneticum AMB-1]
 gi|82944577|dbj|BAE49441.1| DNA polymerase sliding clamp subunit [Magnetospirillum magneticum
           AMB-1]
          Length = 379

 Score =  287 bits (735), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 149/387 (38%), Positives = 226/387 (58%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+T+ER+ +L+ L H   ++ER+ TIP+  +V L+   GLL + A+  +++I  A+PA 
Sbjct: 8   MKLTIERAALLKSLAHVQSVVERRTTIPILSNVKLEGRGGLLSLNATDMDLDIIEAVPAD 67

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V   G+ T  AH  Y+IVRKL DG+Q+    + E G ++ +  G S F L   P  +FP 
Sbjct: 68  VVRPGATTAPAHTFYEIVRKLPDGSQVEIEHDAESG-QLTLRSGRSKFSLACLPVEDFPV 126

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK--LCAVATDG 178
               E  ++F L+++ LK L++RT FA++TEE RYYLNGI+ H    D    L AVATDG
Sbjct: 127 LSGGELPFTFSLSAAELKTLIDRTRFAISTEETRYYLNGIYLHAAASDGVDVLRAVATDG 186

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  E+ + +  A MP IIVPRK V EI +++   D  + VSLSE+++        ++
Sbjct: 187 HRLARVEITLPSGAAGMPGIIVPRKTVAEIRKLIDETDGEITVSLSETKLKFAFGDAVLT 246

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y+ VIP  NDK L V+C +  QAVDRVS +S+ + +A+KL+L      ++
Sbjct: 247 SKLIDGTFPDYERVIPADNDKVLVVDCKSFAQAVDRVSAISTEKSRAIKLALEKGSATLS 306

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
             + + G A+E +   Y   P++I FN +YL++I+  +       D   F +  + S   
Sbjct: 307 ASSAENGSAVEEIEADYTSTPLEIGFNSRYLMDILAQVEG-----DTARFAMADAASPTV 361

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         +     A YVLMPMR+
Sbjct: 362 VR---------EMTDGGAIYVLMPMRV 379


>gi|163745036|ref|ZP_02152396.1| DNA polymerase III subunit beta [Oceanibulbus indolifex HEL-45]
 gi|161381854|gb|EDQ06263.1| DNA polymerase III subunit beta [Oceanibulbus indolifex HEL-45]
          Length = 372

 Score =  287 bits (735), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 149/387 (38%), Positives = 234/387 (60%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK ++ER+ +L+ +  A  ++ER+NTIP+  +VL++A    +  +A+  +IE+   + A 
Sbjct: 1   MKFSIERAALLKAVSQAQSVVERRNTIPILANVLIEAEGSDVSFRATDLDIEVVDKVAAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TVSA LL++IVRKL DGA I+   +   G  + +  G SNF L + P  +FP 
Sbjct: 61  VERAGATTVSATLLHEIVRKLPDGALINLTADTAAG-RLTVEAGRSNFSLATLPREDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHIN--EEDLKLCAVATDG 178
               EY  +F   + VL+ L +++ FA++TEE RYYLNG++ HI   E    L  VATDG
Sbjct: 120 MASSEYASNFSAPAPVLRRLFDKSKFAISTEETRYYLNGVYLHIADAESGKALRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  + ++    A+MP +IVPRK VGE+ ++L   +  + VS+SE++I      ++++
Sbjct: 180 HRLARIDAEMPEGAAEMPGVIVPRKTVGELRKLLDDDEMEIAVSVSETKIRFATPGITLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  N +++ V+  +  +AVDRV+ +SS R +AVKL L  D+L ++
Sbjct: 240 SKVIDGTFPDYTRVIPQGNTRKMEVDAADFARAVDRVATVSSERSRAVKLQLDEDRLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V Y +  ++I FN KYLLEI     + +V  +  VF  +SS     
Sbjct: 300 VNAPDSGAAEEELAVAYADERLEIGFNAKYLLEI-----ASQVDRENAVFLFNSSGDPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         + N  +A YV+MPMR+
Sbjct: 355 MR---------EGNDTSAVYVVMPMRV 372


>gi|307295044|ref|ZP_07574886.1| DNA polymerase III, beta subunit [Sphingobium chlorophenolicum L-1]
 gi|306879518|gb|EFN10736.1| DNA polymerase III, beta subunit [Sphingobium chlorophenolicum L-1]
          Length = 370

 Score =  287 bits (735), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 149/387 (38%), Positives = 238/387 (61%), Gaps = 19/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQAN-DGLLEIKASGPEIEITGAIPA 59
           MK T+ER+ +L+ L H   ++ER+NTIP+  +VL++A+ DG +++ A+  +++I  ++ A
Sbjct: 1   MKATIERATLLKSLSHVQSVVERRNTIPILSNVLIEASSDGAIKLMATDLDLQIVESVSA 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            V+  G+ T+SAH L+DI RKL +G+Q+S         ++ I  G + F L + P  +FP
Sbjct: 61  QVEQAGATTISAHTLFDIARKLPEGSQVSLHAAE---GKMLIQAGRARFNLSTLPRDDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK-LCAVATDG 178
              E +   SFEL +  LK ++++T FA++TEE RYYLNGI+FH++++    L A ATDG
Sbjct: 118 VIAEGDLPTSFELPAETLKQIIDKTRFAISTEETRYYLNGIYFHVSDDGQPVLKAAATDG 177

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA   V        MP IIVPRK +GE+ ++L   + SV++SLS S+I   + S  ++
Sbjct: 178 HRLARVTVPRPDGADGMPGIIVPRKCIGELRKLLDEVEGSVQISLSASKIRFGLGSAILT 237

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP +NDK L+++  +  + VDRV+ +++ + +AVK++L  DK+ ++
Sbjct: 238 SKLIDGTFPDYSRVIPTANDKLLKIDPRSFEEGVDRVATIATEKTRAVKMTLDRDKITLS 297

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V +P+ G A E +   +     DI FN +YLL+I+  I S     D V   L  + +   
Sbjct: 298 VTSPENGTAAEEVPGAFQGEGFDIGFNARYLLDILGQIDS-----DLVELHLADAAAPTL 352

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           IR         +D++  A YVLMPMR+
Sbjct: 353 IR---------EDDRSPALYVLMPMRV 370


>gi|163733263|ref|ZP_02140707.1| DNA polymerase III subunit beta [Roseobacter litoralis Och 149]
 gi|161393798|gb|EDQ18123.1| DNA polymerase III subunit beta [Roseobacter litoralis Och 149]
          Length = 372

 Score =  287 bits (734), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 147/387 (37%), Positives = 238/387 (61%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKI++ER+ +L+ +  A  ++ER+NTIP+  +VL++A    +  +A+  +IE+    PA 
Sbjct: 1   MKISIERAALLKAVSQAQSVVERRNTIPILANVLIEAEGSDVSFRATDLDIEVVDKAPAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TVSA  L++IVRKL DGA ++   ++  G  + +  G SNF L + P+ +FP 
Sbjct: 61  VERAGATTVSATTLHEIVRKLPDGALVTLTADSATG-RLTVEAGRSNFSLATLPKEDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK--LCAVATDG 178
               EY  +F   + VL+ L +++ FA++TEE RYYLNG++ H+ + +    L  VATDG
Sbjct: 120 MATSEYQSNFSAKAPVLRRLFDKSKFAISTEETRYYLNGVYMHVADAEGGRVLRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  + D+      MP +IVPRK VGE+ ++L + + ++ VS+SE+++      ++++
Sbjct: 180 HRLARIDADLPEDANDMPGVIVPRKTVGELRKLLDNDEMTIAVSVSETKVRFATPDITLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  N ++L V+  +  +AVDRV+ +SS R +AVKL L  D+L ++
Sbjct: 240 SKVIDGTFPDYTRVIPQGNTRKLEVDAADFARAVDRVATVSSERSRAVKLQLDEDRLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V Y +  ++I FN KYLLEI     + +V  +  VF  +SS     
Sbjct: 300 VNAPDSGAAEEELAVAYADERLEIGFNAKYLLEI-----ASQVDRENAVFLFNSSGDPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         + N ++A YV+MPMR+
Sbjct: 355 MR---------EGNDLSAVYVVMPMRV 372


>gi|255261800|ref|ZP_05341142.1| DNA polymerase III, beta subunit [Thalassiobium sp. R2A62]
 gi|255104135|gb|EET46809.1| DNA polymerase III, beta subunit [Thalassiobium sp. R2A62]
          Length = 372

 Score =  286 bits (733), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 150/387 (38%), Positives = 234/387 (60%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKI++ERS +L+ +  A  ++ER+NTIP+  +VL++A       +A+  +IE+    PA 
Sbjct: 1   MKISIERSILLKAVAQAQSVVERRNTIPILANVLIEAEGDSATFRATDLDIEVVDKAPAM 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV+A  L +IVRKL DGA ++   ++  G  + I  G SNF L + P+ +FP 
Sbjct: 61  VERAGATTVAAVTLNEIVRKLPDGALVTLTDDSATG-RLTIEAGRSNFSLATLPKEDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK--LCAVATDG 178
               EY  +F   + VL+ L +++ FA++TEE RYYLNG++ H+ + D    L  VATDG
Sbjct: 120 MASSEYAANFSAPAPVLRRLFDKSKFAISTEETRYYLNGVYMHVADSDGGKVLRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  + D+    + M  +IVPRK VGE+ ++L   D  + VS+SE+++      ++++
Sbjct: 180 HRLARIDADLPDGASDMAGVIVPRKTVGELRKLLDDDDVQIAVSVSETKVRFATPEITLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  N ++L V+  +  +AVDRV+ +SS R +AVKL L  D+L ++
Sbjct: 240 SKVIDGTFPDYTRVIPQGNTRKLEVDAADFAKAVDRVATVSSERSRAVKLQLDEDRLILS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V YN+  ++I FN KYLLEI     + +V  +  VF  +SS     
Sbjct: 300 VNAPDSGAAEEEIAVAYNDERLEIGFNAKYLLEI-----ASQVDRENAVFMFNSSGDPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         + N  +A YV+MPMR+
Sbjct: 355 MR---------EGNDTSAVYVVMPMRV 372


>gi|103486201|ref|YP_615762.1| DNA polymerase III subunit beta [Sphingopyxis alaskensis RB2256]
 gi|98976278|gb|ABF52429.1| DNA polymerase III, beta subunit [Sphingopyxis alaskensis RB2256]
          Length = 371

 Score =  286 bits (733), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 153/388 (39%), Positives = 234/388 (60%), Gaps = 20/388 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQAND-GLLEIKASGPEIEITGAIPA 59
           MK T+ER+ +L+ LGH   ++ER+NTIP+  +VL++A+  G L + A+  ++++   I A
Sbjct: 1   MKATIERAVLLKSLGHVQSVVERRNTIPILSNVLIEADGTGQLRLMATDLDLQVVETIAA 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            V+  G+ TVSAH L++I RKL +G+++S         +V +  G SNF L + P  +FP
Sbjct: 61  KVETPGTTTVSAHTLFEIARKLPEGSEVSLAAAE---GKVQVKAGRSNFNLPTLPRDDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK--LCAVATD 177
              E +   +FEL  + L  ++++T FA++TEE RYYLNGIF H+ E+     L A ATD
Sbjct: 118 VIAEGDLPTNFELPVAELIQIIDKTRFAISTEETRYYLNGIFLHVAEDATGPVLKAAATD 177

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLA   V      A MP +IVPRK VGEI ++L   + +V++SLS S+I   + +  +
Sbjct: 178 GHRLARYTVTRPDGAAGMPDVIVPRKCVGEIRKLLDEAEGNVEISLSASKIRFQLGNAVL 237

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +LIDG FP+Y  VIP +NDK L+V+  +L Q VDRVS ++S + +AVK+ L  D++ +
Sbjct: 238 TSKLIDGTFPDYSRVIPTANDKLLKVDPKSLFQGVDRVSTIASEKTRAVKVGLDKDRITL 297

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           +V +P+ G A E +   Y+   M+I FN +YL +I+  +       D V   L  +N+  
Sbjct: 298 SVTSPENGTAAEELAAAYDSDAMEIGFNARYLSDILGQVDG-----DSVELHLADANAPT 352

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            IR  +K           A YVLMPMR+
Sbjct: 353 LIRESEKSP---------ALYVLMPMRV 371


>gi|89069838|ref|ZP_01157173.1| DNA polymerase III subunit beta [Oceanicola granulosus HTCC2516]
 gi|89044639|gb|EAR50755.1| DNA polymerase III subunit beta [Oceanicola granulosus HTCC2516]
          Length = 372

 Score =  286 bits (733), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 153/387 (39%), Positives = 234/387 (60%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK ++ER  +L+ +  A  ++ER+NTIP+  +VL++A    ++ +A+  +IE+    PA 
Sbjct: 1   MKFSIERGALLKAVAQAQSVVERRNTIPILANVLIEAEGDGVQFRATDLDIEVVDRAPAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV+A  L +IVRKL DGA ++  ++   G  + I  G SNF L + P  +FP 
Sbjct: 61  VERAGATTVAAVTLNEIVRKLPDGALVTLAEDGGSG-RLQIMAGRSNFSLATLPREDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINE-EDLK-LCAVATDG 178
               EY  +F   + VL+ L +++ FA++TEE RYYLNG++ H+ E ED + L  VATDG
Sbjct: 120 MASSEYATNFTADAPVLRRLFDKSKFAISTEETRYYLNGVYMHVAEGEDGRALRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  +  +     +MP +IVPRK VGE+ ++L   +  + VS+SE++I      ++++
Sbjct: 180 HRLARIDAALPEGAEEMPGVIVPRKTVGELRKLLDDDEMQIAVSVSETKIRFATPDITLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP +N K L V+ +   +AVDRV+ +SS R +AVKLSL  D+L ++
Sbjct: 240 SKVIDGTFPDYSRVIPANNAKRLEVDASEFAKAVDRVATVSSERSRAVKLSLDEDRLILS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V Y +  +DI FN KYLLEI     + +V  +  VF  +SS     
Sbjct: 300 VNAPDSGNAEEELAVAYGDEKLDIGFNAKYLLEI-----ASQVDRENAVFLFNSSGDPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R  D  S         A YV+MPMR+
Sbjct: 355 MREGDDTS---------AVYVVMPMRV 372


>gi|84514653|ref|ZP_01002017.1| DNA polymerase III subunit beta [Loktanella vestfoldensis SKA53]
 gi|84511704|gb|EAQ08157.1| DNA polymerase III subunit beta [Loktanella vestfoldensis SKA53]
          Length = 372

 Score =  286 bits (733), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 151/387 (39%), Positives = 235/387 (60%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK ++ER+ +L+ +  A  ++ER+NTIP+  +VL++A    +  +A+  +IEI    PA 
Sbjct: 1   MKFSIERAVLLKAVAQAQSVVERRNTIPILANVLIEAQGDEVHFRATDLDIEIVDKAPAK 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           VD  G+ TVSA  L +IVRKL DGA ++  +E+  G  + I  G SNF L + P+ +FP 
Sbjct: 61  VDRAGATTVSAVTLNEIVRKLPDGALVTLTEESATG-RLTIEAGRSNFSLATLPKEDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
               +Y  +F   + VL+ L +++ FA++TEE RYYLNG++ H+   E    L  VATDG
Sbjct: 120 MASSDYAANFSAKAPVLRRLFDKSKFAISTEETRYYLNGVYMHVADGENGKVLRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  + ++      M  +IVPRK VGE+ ++L   D  + VS+SE++I      ++++
Sbjct: 180 HRLARIDAELPMGAENMAGVIVPRKTVGELRKLLDDDDMKIAVSVSETKIRFATPDITLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  N + L V+ +   +AVDRV+ +SS R +AVKLSL  D+L ++
Sbjct: 240 SKVIDGTFPDYTRVIPQGNTRRLEVDASEFARAVDRVATVSSERSRAVKLSLDEDRLILS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V++PD G A E + V Y++  ++I FN KYLLEI     + +V  +  VF  +SS     
Sbjct: 300 VNSPDSGAAEEELAVAYSDERLEIGFNAKYLLEI-----ASQVDRENAVFMFNSSGDPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         + N ++A YV+MPMR+
Sbjct: 355 MR---------EGNDMSAIYVVMPMRV 372


>gi|83591342|ref|YP_425094.1| DNA polymerase III subunit beta [Rhodospirillum rubrum ATCC 11170]
 gi|83574256|gb|ABC20807.1| DNA polymerase III, beta subunit [Rhodospirillum rubrum ATCC 11170]
          Length = 372

 Score =  286 bits (731), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 146/387 (37%), Positives = 231/387 (59%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+T+ER+ +L+ LGH   ++ER+NTIP+  +V ++  +    + A+  ++EI   + A+
Sbjct: 1   MKLTIERTALLKSLGHVQSVVERRNTIPILSNVRMETGESGFSLNATDMDLEIVETVTAT 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               G+ T  AH LYDIVRKL DG+Q+    +   G ++ +  G S F L   P  +FP+
Sbjct: 61  TLAPGATTAPAHTLYDIVRKLPDGSQVELSYDGNDG-QLVLKAGRSRFSLSCLPVEDFPA 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
               E+ +SF L ++ L+ L++RT FA++TEE RYYLNGI+ H  E      L AVATDG
Sbjct: 120 LSAGEFSHSFSLPATDLRGLIDRTRFAISTEETRYYLNGIYLHATESAGVPVLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA AE+ + A  A MP +IVPRK VGE+ +++      + V LSE +I  + +   ++
Sbjct: 180 HRLARAEIPLPAGAAGMPGVIVPRKTVGELRKLIEETGMDITVGLSEQKIRFDFDETRLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y+ VIP  NDK L V+C    QA DRVS +S+ + +A+K++++   + ++
Sbjct: 240 SKLIDGTFPDYERVIPTENDKVLEVDCKLFAQAADRVSAISTEKSRAIKVAVAKGTMTLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
             +PD G A+E +   Y    ++I FN +YLL+I+  +    V    + F  D+++ +V 
Sbjct: 300 ASSPDAGSAVEEIEAAYQSTSLEIGFNSRYLLDILGQVEGGSV---RLTF-ADAASPTVI 355

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
                +D  +      +A YVLMPMR+
Sbjct: 356 -----RDVAD-----ASAVYVLMPMRV 372


>gi|126460790|ref|YP_001041904.1| DNA polymerase III subunit beta [Rhodobacter sphaeroides ATCC
           17029]
 gi|332559820|ref|ZP_08414142.1| DNA polymerase III subunit beta [Rhodobacter sphaeroides WS8N]
 gi|126102454|gb|ABN75132.1| DNA polymerase III, beta subunit [Rhodobacter sphaeroides ATCC
           17029]
 gi|332277532|gb|EGJ22847.1| DNA polymerase III subunit beta [Rhodobacter sphaeroides WS8N]
          Length = 372

 Score =  286 bits (731), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 149/387 (38%), Positives = 232/387 (59%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKI++ER  +L+ +G A  ++ER+NTIP+  +VL++A    +  +A+  +IE+    PA 
Sbjct: 1   MKISIERGALLKAVGQAQSVVERRNTIPILANVLIEAEGDTVSFRATDLDIEVVDRTPAV 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TVSA +L++IVRKL DGA +    E+     + ++ G S F L + P  +FP 
Sbjct: 61  VERAGATTVSAVMLHEIVRKLPDGALVGL-SEDPASGRLTVTAGRSVFSLATLPREDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
               EY  +F+  + VL+ L ++  FA++TEE RYYLNG++ H+   EE   L  VATDG
Sbjct: 120 MASSEYSSTFKAPAPVLRRLFDKAKFAISTEETRYYLNGVYMHVATGEEGPVLRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  +  +      MP +IVPRK V E+ ++L   +  + VS+SE+++      ++M+
Sbjct: 180 HRLARIDAALPEGAQGMPGVIVPRKTVNELRKLLDDDEVEIAVSVSETKVRFATPQITMT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP +N + L V+     +AVDRV+ +SS R +AVKLSL  D+L ++
Sbjct: 240 SKVIDGTFPDYSRVIPTANARRLEVDAQEFAKAVDRVATVSSERSRAVKLSLDEDRLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V Y +  ++I FN KYLLEI     + +V  +  VF  +SS     
Sbjct: 300 VNAPDSGAAEEELAVAYGDERLEIGFNAKYLLEI-----ASQVDRENAVFLFNSSGDPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         + N ++A YV+MPMR+
Sbjct: 355 MR---------EGNDMSAVYVVMPMRV 372


>gi|77464921|ref|YP_354425.1| DNA polymerase III subunit beta [Rhodobacter sphaeroides 2.4.1]
 gi|77389339|gb|ABA80524.1| DNA polymerase III, beta subunit [Rhodobacter sphaeroides 2.4.1]
          Length = 372

 Score =  286 bits (731), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 149/387 (38%), Positives = 232/387 (59%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKI++ER  +L+ +G A  ++ER+NTIP+  +VL++A    +  +A+  +IE+    PA 
Sbjct: 1   MKISIERGALLKAVGQAQSVVERRNTIPILANVLIEAEGDTVSFRATDLDIEVVDRTPAV 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TVSA +L++IVRKL DGA +    E+     + ++ G S F L + P  +FP 
Sbjct: 61  VERAGATTVSAVMLHEIVRKLPDGALVGL-SEDPASGRLTVTAGRSVFSLATLPREDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
               EY  +F+  + VL+ L ++  FA++TEE RYYLNG++ H+   EE   L  VATDG
Sbjct: 120 MASSEYSSTFKAPAPVLRRLFDKAKFAISTEETRYYLNGVYMHVATGEEGSVLRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  +  +      MP +IVPRK V E+ ++L   +  + VS+SE+++      ++M+
Sbjct: 180 HRLARIDAALPEGAQGMPGVIVPRKTVNELRKLLDDDEVEIAVSVSETKVRFATPQITMT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP +N + L V+     +AVDRV+ +SS R +AVKLSL  D+L ++
Sbjct: 240 SKVIDGTFPDYSRVIPTANARRLEVDAQEFAKAVDRVATVSSERSRAVKLSLDEDRLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V Y +  ++I FN KYLLEI     + +V  +  VF  +SS     
Sbjct: 300 VNAPDSGAAEEELAVAYGDERLEIGFNAKYLLEI-----ASQVDRENAVFLFNSSGDPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         + N ++A YV+MPMR+
Sbjct: 355 MR---------EGNDMSAVYVVMPMRV 372


>gi|149912811|ref|ZP_01901345.1| DNA polymerase III, beta subunit [Roseobacter sp. AzwK-3b]
 gi|149813217|gb|EDM73043.1| DNA polymerase III, beta subunit [Roseobacter sp. AzwK-3b]
          Length = 372

 Score =  285 bits (730), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 145/387 (37%), Positives = 235/387 (60%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+++ER  +L+ +  A  ++ER+NTIP+  +VL++A    ++ +A+  +IE+    PA 
Sbjct: 1   MKLSIERGTLLKAVAQAQSVVERRNTIPILANVLIEAEGDTVQFRATDLDIEVVDKAPAK 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV+A +L++IVRKL DGA ++   ++  G  + +  G SNF L + P+ +FP 
Sbjct: 61  VERAGATTVNAVMLHEIVRKLPDGALVTLTDDSATG-RLTVEAGRSNFNLATLPKEDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK--LCAVATDG 178
               EY  +F   + VL  L +++ FA++TEE RYYLNG++ H+ + +    L  VATDG
Sbjct: 120 MASSEYASNFSAPAPVLLRLFDKSKFAISTEETRYYLNGVYMHVADAEGGKVLRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  + D+      MP +IVPRK VGE+ ++L   D  + VS+SE+++      ++++
Sbjct: 180 HRLARIDADLPIGAEDMPGVIVPRKTVGELRKLLEDDDMKIAVSVSETKVRFATPDITLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  N +++ V+     +AVDRV+ +SS R +AVKL+L  D+L ++
Sbjct: 240 SKVIDGTFPDYTRVIPQGNTRKMEVDAAEFAKAVDRVATVSSERSRAVKLTLDEDRLILS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V Y +  ++I FN KYLLEI     + +V  +  VF  +SS     
Sbjct: 300 VNAPDSGAAEEELAVAYGDERLEIGFNAKYLLEI-----ASQVDRENAVFMFNSSGDPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         + N  +A YV+MPMR+
Sbjct: 355 MR---------EGNDTSAVYVVMPMRV 372


>gi|146276061|ref|YP_001166220.1| DNA polymerase III subunit beta [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554302|gb|ABP68915.1| DNA polymerase III, beta subunit [Rhodobacter sphaeroides ATCC
           17025]
          Length = 372

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 150/387 (38%), Positives = 231/387 (59%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKI++ER  +L+ +G A  ++ER+NTIP+  +VL++A    +  +A+  +IE+    PA 
Sbjct: 1   MKISIERGALLKAVGQAQSVVERRNTIPILANVLIEAEGDTVSFRATDLDIEVVDRTPAV 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TVSA +L++IVRKL DGA +    E+     + ++ G S F L + P  +FP 
Sbjct: 61  VERPGATTVSAVMLHEIVRKLPDGALVGL-SEDAASGRLTVTAGRSVFSLATLPREDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
               EY  +F   + VL+ L ++  FA++TEE RYYLNG+F H+   EE   L  VATDG
Sbjct: 120 MASSEYSSNFTAPAPVLRRLFDKAKFAISTEETRYYLNGVFMHVATGEEGPVLRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  +  +      M  +IVPRK V E+ ++L   ++ +KVS+SE+++      ++M+
Sbjct: 180 HRLARIDAPLPEGAEGMAGVIVPRKTVNELRKLLDDDEAQIKVSVSETKVRFATPQITMT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  N + L V+     +AVDRV+ +SS R +AVKLSL  D+L ++
Sbjct: 240 SKVIDGTFPDYSRVIPTGNARRLEVDAQEFAKAVDRVATVSSERSRAVKLSLDEDRLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V Y +  ++I FN KYLLEI     + +V  +  VF  +SS     
Sbjct: 300 VNAPDSGAAEEELAVAYGDERLEIGFNAKYLLEI-----ASQVDRENAVFLFNSSGDPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         + N ++A YV+MPMR+
Sbjct: 355 MR---------EGNDMSAVYVVMPMRV 372


>gi|209966326|ref|YP_002299241.1| DNA polymerase III subunit beta [Rhodospirillum centenum SW]
 gi|209959792|gb|ACJ00429.1| DNA polymerase III, beta subunit [Rhodospirillum centenum SW]
          Length = 374

 Score =  284 bits (727), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 149/391 (38%), Positives = 232/391 (59%), Gaps = 23/391 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKIT+ER+ +L  LGH   ++ER+NTIP+  +V+L+A +G L + A+  ++EI  ++PA 
Sbjct: 1   MKITIERAALLRSLGHVQSVVERRNTIPILSNVMLRAENGELSLTATDMDLEIVESVPAD 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           +   GS T  AH LYDI RKL DG+Q+     +  G  + +  G S F L + P  ++P+
Sbjct: 61  IARPGSATAPAHTLYDIARKLPDGSQVEL---DSTGDMLTLRSGRSQFKLGTLPVDDYPA 117

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINE------EDLKLCAV 174
               +  + F L+++ LK L++RT FA++TEE RYYLNGIF H +       E   L AV
Sbjct: 118 MSGGDMGHRFSLSAADLKALIDRTRFAISTEETRYYLNGIFLHASTARGAGGETPVLRAV 177

Query: 175 ATDGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIES 234
           ATDGHRLA  E+ +    A +P +I+PRKAV E+ ++L      ++V LS++++    ++
Sbjct: 178 ATDGHRLARVEMPLPEGAAGIPGVIIPRKAVLEVRKLLDEAADRIEVQLSDTKVRFAFDA 237

Query: 235 LSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDK 294
           ++++ +LIDG FP+Y+ VIP  NDK L V+      AVDRV+ +S+ + +AVKLSL    
Sbjct: 238 ITLTSKLIDGTFPDYERVIPTGNDKVLEVDPRLFAGAVDRVATISTEKSRAVKLSLDRGV 297

Query: 295 LCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSN 354
           L ++  +P+ G A E + V Y+   ++I FN +YLL+I   I       +   F +  + 
Sbjct: 298 LTLSASSPEAGSATEELEVVYDAPALEIGFNSRYLLDITQQIEG-----EGARFTMADAG 352

Query: 355 SSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           S   +R    D  +      +A YVLMPMR+
Sbjct: 353 SPTLVR----DVAD-----ASALYVLMPMRV 374


>gi|126734081|ref|ZP_01749828.1| DNA polymerase III subunit beta [Roseobacter sp. CCS2]
 gi|126716947|gb|EBA13811.1| DNA polymerase III subunit beta [Roseobacter sp. CCS2]
          Length = 372

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 148/387 (38%), Positives = 235/387 (60%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK ++ER+ +L+ +  A  ++ER+NTIP+  +VL++A    ++ +A+  +IE+     A 
Sbjct: 1   MKFSIERAVLLKAVAQAQSVVERRNTIPILANVLIEAEGDSVQFRATDLDIEVVDRASAK 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV+A  L +IVRKL DGA ++  ++   G  + I  G SNF L + P+ +FP 
Sbjct: 61  VERAGATTVAAVTLNEIVRKLPDGALVTLTEDGASG-RLTIEAGRSNFSLATLPKEDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK--LCAVATDG 178
               EY  +F   + VL+ L +++ FA++TEE RYYLNG++ H+++ D    L  VATDG
Sbjct: 120 MASSEYAANFSAPAPVLRRLFDKSKFAISTEETRYYLNGVYMHVSDSDGGKVLRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  + D+    A M  +IVPRK VGE+ ++L   D  + VS+SE++I      ++++
Sbjct: 180 HRLARIDADLPDGAADMAGVIVPRKTVGELRKLLDDDDMQIAVSVSETKIRFATPDITLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  N ++L V+ +   +AVDRV+ +SS R +AVKL+L  DKL ++
Sbjct: 240 SKVIDGTFPDYTRVIPQGNTRKLEVDASEFAKAVDRVATVSSERSRAVKLALDEDKLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V Y +  ++I FN KYLLEI     + +V  +  VF  ++S     
Sbjct: 300 VNAPDSGAAEEELAVAYGDERLEIGFNAKYLLEI-----ASQVDRENAVFMFNTSGDPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         + N  +A YV+MPMR+
Sbjct: 355 MR---------EGNDTSAVYVVMPMRV 372


>gi|83855143|ref|ZP_00948673.1| DNA polymerase III subunit beta [Sulfitobacter sp. NAS-14.1]
 gi|83941666|ref|ZP_00954128.1| DNA polymerase III subunit beta [Sulfitobacter sp. EE-36]
 gi|83842986|gb|EAP82153.1| DNA polymerase III subunit beta [Sulfitobacter sp. NAS-14.1]
 gi|83847486|gb|EAP85361.1| DNA polymerase III subunit beta [Sulfitobacter sp. EE-36]
          Length = 372

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 149/387 (38%), Positives = 236/387 (60%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK ++ER+ +L+ +  A  ++ER+NTIP+  +VL++A       +A+  +IE+     A 
Sbjct: 1   MKFSIERAALLKAVSQAQSVVERRNTIPILANVLIEAEGSDASFRATDLDIEVVDKAAAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TVSA  L++IVRKL DGA IS   ++  G  + +  G SNF L + P  +FP 
Sbjct: 61  VERAGATTVSATTLHEIVRKLPDGALISLTADSAAG-RLTVEAGRSNFSLATLPREDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK--LCAVATDG 178
               EY  +F+  + VL+ L +++ FA++TEE RYYLNG++ HI++ +    L  VATDG
Sbjct: 120 MATSEYQSNFKAPAPVLRRLFDKSKFAISTEETRYYLNGVYMHISDSEGSKVLRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  +  +    A+MP +IVPRK VGE+ ++L   D  + VS+SE++I      ++++
Sbjct: 180 HRLARIDAPMPEGAAEMPGVIVPRKTVGELRKLLDDDDMEIAVSVSETKIRFATPDITLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  N +++ V+ ++  +AVDRV+ +SS R +AVKL L  D+L ++
Sbjct: 240 SKVIDGTFPDYTRVIPQGNTRKMEVDASDFARAVDRVATVSSERSRAVKLQLDEDRLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V Y +  ++I FN KYLLEI     + +V  +  VF  +SS     
Sbjct: 300 VNAPDSGAAEEELVVAYADERLEIGFNAKYLLEI-----ASQVDRENAVFLFNSSGDPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         + N ++A YV+MPMR+
Sbjct: 355 MR---------EGNDMSAVYVVMPMRV 372


>gi|159045914|ref|YP_001534708.1| DNA polymerase III subunit beta [Dinoroseobacter shibae DFL 12]
 gi|157913674|gb|ABV95107.1| DNA polymerase III subunit beta [Dinoroseobacter shibae DFL 12]
          Length = 372

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 149/388 (38%), Positives = 234/388 (60%), Gaps = 19/388 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKI++ER+ +L  +  A  ++ER+NTIP+  +VL++A    +  +A+  +IE+   + A 
Sbjct: 1   MKISIERATLLRAVSQAQSVVERRNTIPILANVLIEAEGDSVSFRATDLDIEVVDRVTAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV A  L++IVRKL DGA ++   +   G  + +S G SNF L + P  +FP 
Sbjct: 61  VERAGATTVPAVTLHEIVRKLPDGALVALTHDTAKG-RLEVSAGRSNFSLATLPREDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
               EY  +F   + VL+ L +++ FA++TEE RYYLNG++ H+   E    L  VATDG
Sbjct: 120 MTTTEYTCNFAAPAPVLRRLFDKSKFAISTEETRYYLNGVYMHVADGENGRSLRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  + D+      MP +IVPRK VGE+ ++L   ++ + VS+SE++I      ++++
Sbjct: 180 HRLARIDADLPDAAEGMPGVIVPRKTVGELRKLLEDDEAQIAVSVSETKIRFATPEITLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP SN ++L V+ +   +AVDRV+ +SS R +AVKL+L  D+L ++
Sbjct: 240 SKVIDGTFPDYTRVIPVSNSRKLEVDASEFAKAVDRVATVSSERSRAVKLALDEDRLILS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V Y +  ++I FN KYLLEI     + +V  +  VF  +S+     
Sbjct: 300 VNAPDSGAAEEELAVAYGDERLEIGFNAKYLLEI-----ASQVDRENAVFLFNSAADPTM 354

Query: 359 IR-GKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R G D           +A YV+MPMR+
Sbjct: 355 MREGSDS----------SAIYVVMPMRV 372


>gi|254486821|ref|ZP_05100026.1| DNA polymerase III, beta subunit [Roseobacter sp. GAI101]
 gi|214043690|gb|EEB84328.1| DNA polymerase III, beta subunit [Roseobacter sp. GAI101]
          Length = 372

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 148/387 (38%), Positives = 234/387 (60%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK ++ER+ +L+ +  A  ++ER+NTIP+  +VL++A       +A+  +IE+    PA 
Sbjct: 1   MKFSIERAALLKAVSQAQSVVERRNTIPILANVLIEAEGSDASFRATDLDIEVVDKAPAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           ++  G+ TVSA  L++IVRKL DGA I+   ++  G  + +  G SNF L + P  +FP 
Sbjct: 61  IERAGATTVSATTLHEIVRKLPDGALITLTSDSAAG-RLTVEAGRSNFSLATLPREDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK--LCAVATDG 178
               EY  +F   + VL+ L +++ FA++TEE RYYLNG++ HI+E +    L  VATDG
Sbjct: 120 MASSEYQSNFSAPAPVLRRLFDKSKFAISTEETRYYLNGVYMHISESEGNKVLRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  +  +      MP +IVPRK VGE+ ++L   D  + VS+SE++I      ++++
Sbjct: 180 HRLARIDAPMPEGADDMPGVIVPRKTVGELRKLLDDDDMQIAVSVSETKIRFATPDITLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  N +++ V+ ++  +AVDRV+ +SS R +AVKL L  D+L ++
Sbjct: 240 SKVIDGTFPDYTRVIPQGNTRKMEVDASDFARAVDRVATVSSERSRAVKLQLDEDRLILS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V Y +  ++I FN KYLLEI     + +V  +  VF  +SS     
Sbjct: 300 VNAPDSGAAEEELVVAYADERLEIGFNAKYLLEI-----ASQVDRENAVFLFNSSGDPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         + N ++A YV+MPMR+
Sbjct: 355 MR---------EGNDMSAVYVVMPMRV 372


>gi|304319870|ref|YP_003853513.1| DNA polymerase III subunit beta [Parvularcula bermudensis HTCC2503]
 gi|303298773|gb|ADM08372.1| DNA polymerase III subunit beta [Parvularcula bermudensis HTCC2503]
          Length = 373

 Score =  283 bits (725), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 145/388 (37%), Positives = 231/388 (59%), Gaps = 18/388 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T+ER+ +L+ L H   ++ER+NTIP+  +VL++A  G L + A+  +IEI   +PA 
Sbjct: 1   MQVTIERATLLKALHHTQSVVERRNTIPILSNVLMRAQGGSLALTATDLDIEIAETVPAE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           +   G +T SA  LYDIV++L DG QIS  K +   + + +  G S F L   P+ +FP+
Sbjct: 61  IAEEGGVTASAVTLYDIVKRLPDGGQISLNKSSG-SSRLMLKSGRSEFQLSILPDDDFPT 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI---NEEDLKLCAVATD 177
             +E    +F +++  L  L++RT FAM+ EE RYYLNG++ H     E    L AVATD
Sbjct: 120 LSDEAAGATFTISADALGRLLDRTRFAMSQEETRYYLNGVYLHALTEGEGAPSLRAVATD 179

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLA  +  +      +P +I+PRKAV E+ R+L   D  V V+++ ++I      + +
Sbjct: 180 GHRLARLDSPLPPGAEAIPGVIIPRKAVLELRRLLDDADGDVAVTVTPAKIRFAFGDIVL 239

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
             +LIDG FP+YQ VIP  ND+ ++V+    R+AVDRVS +S+ + ++VKLSL+ D+L +
Sbjct: 240 VSKLIDGTFPDYQRVIPSGNDRVMKVDNDAFRRAVDRVSTVSADKTRSVKLSLTEDQLTL 299

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
            V+NP+ G A + ++V +    +++ FN +YLL+I D IS      +  VF    + S  
Sbjct: 300 LVNNPETGSATDELSVDFKSTDLEVGFNARYLLDIADQISG-----ETAVFHFADAASPT 354

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            +  ++ +          A YVLMP+R+
Sbjct: 355 LVTDEEDE---------GALYVLMPLRV 373


>gi|126730157|ref|ZP_01745969.1| DNA polymerase III subunit beta [Sagittula stellata E-37]
 gi|126709537|gb|EBA08591.1| DNA polymerase III subunit beta [Sagittula stellata E-37]
          Length = 372

 Score =  283 bits (724), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 150/387 (38%), Positives = 232/387 (59%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKI++ER+ +L  +  A  ++ER+NTIP+  +VL++A    +  +A+  +IE+     A 
Sbjct: 1   MKISMERATLLRAVAQAQSVVERRNTIPILANVLIEAEGETVTFRATDLDIEVLDKAEAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G  TVSA  L++IVRKL DGA +   +E   G  + +S G SNF L + P+ +FP 
Sbjct: 61  VEKPGGTTVSAVTLHEIVRKLPDGALVVLAEEPGTG-RLTVSAGRSNFNLATLPKEDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
               EY  +F   + VL+ L +++ FA++TEE RYYLNG++ H+ + D    L  VATDG
Sbjct: 120 MASSEYGSNFTAKAEVLRRLFDKSKFAISTEETRYYLNGVYMHVADGDGGQALRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  +  +    A MP +IVPRK VGE+ ++L   D  + VS+SE+++      ++++
Sbjct: 180 HRLARIDAPLPDGAADMPGVIVPRKTVGEMRKLLDEDDMDIAVSVSETKVRFATPDITLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  N ++L V+ +   +AVDRV+ +SS R +AVKL L  D+L ++
Sbjct: 240 SKVIDGTFPDYTRVIPQGNTRKLEVDASEFAKAVDRVATVSSERSRAVKLQLDEDRLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V Y +  ++I FN KYLLEI     + +V  +  VF  +SS     
Sbjct: 300 VNAPDSGAAEEELAVAYGDERLEIGFNAKYLLEI-----ASQVDRENAVFMFNSSGDPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         + N  +A YV+MPMR+
Sbjct: 355 MR---------EGNDTSAVYVVMPMRV 372


>gi|254295379|ref|YP_003061402.1| DNA polymerase III subunit beta [Hirschia baltica ATCC 49814]
 gi|254043910|gb|ACT60705.1| DNA polymerase III, beta subunit [Hirschia baltica ATCC 49814]
          Length = 374

 Score =  283 bits (723), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 151/389 (38%), Positives = 235/389 (60%), Gaps = 19/389 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+T++R  +++ L H   ++ER+NTIP+  +VL+ A    L + A+  ++E +    A 
Sbjct: 1   MKLTIDRGALMKALSHVQNVVERRNTIPILSNVLIDAEGTSLRLTATDLDMEASDTTIAH 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           ++  GS+T  A  L+D+VRKL DG+ I    + E    + I+ G S F L + P  +F +
Sbjct: 61  IEKPGSVTAPAQTLFDVVRKLPDGSDIGLLLDTET-RRLTITSGRSRFALPTLPADDFQT 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINE--EDLKLCAVATDG 178
             +EE   SFE+ ++  + L+++T FA++TEE RYYLNG++ H  E    +KL  VATDG
Sbjct: 120 MSKEEAPNSFEIPAADFRRLIDKTKFAISTEETRYYLNGVYMHGTEVGGAVKLRTVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRIL--SSKDSSVKVSLSESRIHLNIESLS 236
           HRLA+AE D       +P II+PRKA+ EI R+L  +++DS V VS SES+I + +    
Sbjct: 180 HRLALAEADAPKGAETLPGIIIPRKAIAEIRRLLDDAAQDSDVSVSTSESKIVVKVGDAV 239

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
           ++ +LIDG FP+Y  VIP SN K L +  +  + AVDRV+ +S+ R ++VKL+L +DKL 
Sbjct: 240 ITSKLIDGSFPDYSRVIPQSNSKILVLKNSEFKSAVDRVATVSAERSRSVKLTLENDKLV 299

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           + V N + G+ +E +   Y++ PM+I FN +YLL++   I       DE+ F L+ S SS
Sbjct: 300 LQVSNAETGQGVEELEAQYSDEPMEIGFNARYLLDVTQQIEG-----DEIRFELNDSASS 354

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +     D  +       A YVLMP+R+
Sbjct: 355 ARV----TDLADQ-----GAQYVLMPLRV 374


>gi|94495788|ref|ZP_01302367.1| DNA polymerase III, beta subunit [Sphingomonas sp. SKA58]
 gi|94424480|gb|EAT09502.1| DNA polymerase III, beta subunit [Sphingomonas sp. SKA58]
          Length = 370

 Score =  283 bits (723), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 149/387 (38%), Positives = 233/387 (60%), Gaps = 19/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQAN-DGLLEIKASGPEIEITGAIPA 59
           MK T+ER+ +L+ L H   ++ER+NTIP+  +VL++A+ DG +++ A+  ++++  +I A
Sbjct: 1   MKATIERATLLKSLSHVQSVVERRNTIPILSNVLIEASADGAIKLMATDLDLQVVESISA 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            V+  G+ T+SAH L+DI RKL +G+Q+S    +    ++ I  G + F L + P  +FP
Sbjct: 61  QVEQPGATTISAHTLFDIARKLPEGSQVSLQAAD---GKMLIQAGRARFNLSTLPRDDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK-LCAVATDG 178
              E +    FEL +  LK ++++T FA++TEE RYYLNGI+FH++EE    L A ATDG
Sbjct: 118 VIAEGDLPTQFELPAETLKQIIDKTRFAISTEETRYYLNGIYFHVSEEGQPVLKAAATDG 177

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA   V        MP IIVPRK +GE+ ++L   + SV++SLS S+I   + S  ++
Sbjct: 178 HRLARVTVPRPDGADGMPGIIVPRKCIGELRKLLDEVEGSVQISLSASKIRFGLGSAILT 237

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP  NDK L+++  +    VDRV+ +++ + +AVK++L  D++ ++
Sbjct: 238 SKLIDGTFPDYSRVIPTGNDKLLKIDPRSFEDGVDRVATIATEKTRAVKMTLDKDRITLS 297

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V +P+ G A E +   +     DI FN +YLL+I+  I S     D V   L  + +   
Sbjct: 298 VTSPENGTAAEEVPGAFQGEGFDIGFNARYLLDILGQIDS-----DLVELHLADAAAPTL 352

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           IR  D            A YVLMPMR+
Sbjct: 353 IRENDASP---------ALYVLMPMRV 370


>gi|23014790|ref|ZP_00054590.1| COG0592: DNA polymerase sliding clamp subunit (PCNA homolog)
           [Magnetospirillum magnetotacticum MS-1]
          Length = 372

 Score =  283 bits (723), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 147/387 (37%), Positives = 226/387 (58%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+T+ER+ +L+ L H   ++ER+ TIP+  +V L+   GLL + A+  +++I  A+PA 
Sbjct: 1   MKLTIERAALLKSLAHVQSVVERRTTIPILSNVKLEGRGGLLSLNATDMDLDIIEAVPAD 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V   G+ T  AH  Y+IVRKL DG+Q+    + E G ++ +  G S F L   P  +FP 
Sbjct: 61  VVRPGATTAPAHTFYEIVRKLPDGSQVEIEFDAESG-QLTLRSGRSKFSLACLPVEDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDL--KLCAVATDG 178
               +  +SF L+++ LK L++RT FA++TEE RYYLNGI+ H    D    L AVATDG
Sbjct: 120 LSGGDLPFSFTLSAAELKTLIDRTRFAISTEETRYYLNGIYLHAAASDGIDVLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  E+ + +  A MP +IVPRK V EI +++   D  + VSLSE+++        ++
Sbjct: 180 HRLARVEITLPSGAAGMPGVIVPRKTVAEIRKLIDETDGEITVSLSETKLKFAFGDAVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y+ VIP  NDK L V+C +  QAVDRVS +S+ + +A+KL+L      ++
Sbjct: 240 SKLIDGTFPDYERVIPADNDKVLVVDCKSFAQAVDRVSAISTEKSRAIKLALEKGSATLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
             + + G A+E +   Y   P++I FN +YL++I+  +       +   F +  + S   
Sbjct: 300 ASSAENGSAVEEIEADYTSTPLEIGFNSRYLMDILAQVEG-----ETARFAMADAASPTV 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         +     A YVLMPMR+
Sbjct: 355 VR---------EMTDGGAIYVLMPMRV 372


>gi|288959567|ref|YP_003449908.1| DNA polymerase III subunit beta [Azospirillum sp. B510]
 gi|288911875|dbj|BAI73364.1| DNA polymerase III subunit beta [Azospirillum sp. B510]
          Length = 376

 Score =  282 bits (721), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 150/391 (38%), Positives = 229/391 (58%), Gaps = 21/391 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M IT+ER+ +L  LGH   ++ER+NTIP+  +VLL+A DG L + A+  ++EI   +PA+
Sbjct: 1   MNITIERAALLRSLGHVQSVVERRNTIPILSNVLLRAGDGELSLAATDMDLEIVETVPAT 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V   G  T  AH L+DIVRKL DG+Q+      + GT + +  G S F L   P  +FP 
Sbjct: 61  VGRPGGTTAPAHTLFDIVRKLPDGSQVELDIGGD-GTILTLRAGRSQFKLSCLPVEDFPQ 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK------LCAV 174
               +  ++F + ++ L+ L++RT FA++TEE RYYLNGI+ H  +  +       L AV
Sbjct: 120 LSSGDLKHNFSVPAADLRGLIDRTRFAISTEETRYYLNGIYLHAAKSKMGGLETPVLRAV 179

Query: 175 ATDGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIES 234
           ATDGHRLA  E+ +      +P +I+PRK V EI +++      +++S+S+++I    +S
Sbjct: 180 ATDGHRLARVEMPLPDGAEGIPGVIIPRKTVTEIRKLVDEAADRIELSMSDNKIRFGFDS 239

Query: 235 LSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDK 294
           + ++ +LIDG FP+Y+ VIP  NDK + V+      AVDRV+ +S+ + +AVKLSL    
Sbjct: 240 VVVTSKLIDGTFPDYERVIPVGNDKVMEVDAKLFAAAVDRVATISTEKSRAVKLSLVRGA 299

Query: 295 LCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSN 354
           L ++  +P+ G A E + V Y E P++I FN +YLL+I   I       +   F L  + 
Sbjct: 300 LTLSATSPESGSATEELEVNYAEAPLEIGFNSRYLLDITQQIEG-----EGAQFTLADAA 354

Query: 355 SSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           S   IR    D  ++      A YVLMPMR+
Sbjct: 355 SPTIIR----DVADS-----TALYVLMPMRV 376


>gi|294675559|ref|YP_003576174.1| DNA polymerase III subunit beta [Rhodobacter capsulatus SB 1003]
 gi|294474379|gb|ADE83767.1| DNA polymerase III, beta subunit [Rhodobacter capsulatus SB 1003]
          Length = 372

 Score =  282 bits (721), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 146/387 (37%), Positives = 232/387 (59%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKI++ER+ +L+ +  A  ++ER+NTIP+  +VL++A    +  +A+  +IE+    PA 
Sbjct: 1   MKISIERAALLKAVSQAQSVVERRNTIPILANVLIEAEGSTVSFRATDLDIEVVDKAPAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TVSA +L++IVRKL DG+ +    +   G  +++  G S+F L + P  +FP 
Sbjct: 61  VERAGATTVSAVMLHEIVRKLPDGSLVQLSDDAAAG-RLSVMAGRSSFNLATLPREDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
               EY  +F   + VLK L +++ FA++TEE RYYLNG++ H+   E+   L  VATDG
Sbjct: 120 MASSEYTANFAAKAGVLKRLFDKSKFAISTEETRYYLNGVYMHVATGEDGPALRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  +  +      MP +IVPRK V E+ ++L   ++ + VS+SE+++      ++++
Sbjct: 180 HRLARIDAVLPEGANGMPGVIVPRKTVNELRKLLDDDEAQIAVSVSETKVRFATPEITLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  N + L V+     +AVDRV+ +SS R +AVKLSL  D+L ++
Sbjct: 240 SKVIDGTFPDYTRVIPMGNTRRLEVDAAEFAKAVDRVATVSSERSRAVKLSLDEDRLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V Y +  ++I FN KYLLEI     + +V  +  VF  +SS     
Sbjct: 300 VNAPDAGAAEEELAVAYGDERLEIGFNAKYLLEI-----ASQVDRENAVFLFNSSGDPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         + N  +A YV+MPMR+
Sbjct: 355 MR---------EGNDTSAVYVVMPMRV 372


>gi|119385559|ref|YP_916614.1| DNA polymerase III subunit beta [Paracoccus denitrificans PD1222]
 gi|119376154|gb|ABL70918.1| DNA polymerase III, beta subunit [Paracoccus denitrificans PD1222]
          Length = 372

 Score =  281 bits (720), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 145/387 (37%), Positives = 230/387 (59%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK ++ER+D+++ +  A  ++ER+NTIP+  +VL++A    +  +A+  + EI    PA 
Sbjct: 1   MKFSIERADLVKAVSQAQSVVERRNTIPILANVLIEAAPEGVSFRATDLDTEIVDRAPAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TVSA +L DI RKL DGA +    +   G  +++  G SNF L + P  +FP 
Sbjct: 61  VERPGATTVSAGMLNDIARKLPDGALVQLSLDAASG-RLSVQAGRSNFSLATLPREDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
               EY  +F   ++VL+ L +++ FA++ EE RYYLNG++ H+   E+   L  VATDG
Sbjct: 120 MSSSEYGANFSAPAAVLRRLFDKSKFAISNEETRYYLNGVYMHVAQTEDGPGLRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  +  + A    MP +IVPRK V E+ ++L   ++ + VS+SE+++     +++++
Sbjct: 180 HRLARIDAPLPAGAEDMPGVIVPRKTVAELRKLLDDDEAEIAVSVSETKVRFATPTITLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  N ++L V+  +  +AVDRV+ +SS R +AVKLSL  D+L ++
Sbjct: 240 SKVIDGTFPDYSRVIPSGNARKLEVDAGDFAKAVDRVATVSSERSRAVKLSLDEDRLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V Y + P++I FN KYL EI   I       +  VF  + S  +  
Sbjct: 300 VNAPDAGAADEELPVAYADEPLEIGFNAKYLHEIASQIER-----ENAVFLFNGSGDAAL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           IR         +    +A YV+MPMR+
Sbjct: 355 IR---------EGGDTSAVYVVMPMRV 372


>gi|144900239|emb|CAM77103.1| DNA polymerase III subunit beta [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 372

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 149/387 (38%), Positives = 223/387 (57%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+T+ER+ +L+ L H   ++ER+NTIP+  +V L+   G L + A+  +++I    PA 
Sbjct: 1   MKLTIERAQLLKSLAHVQSVVERRNTIPILSNVKLEGRPGSLSLNATDMDLDIIETAPAD 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V   G+ T  AH  Y+IVRKL DG+Q+    + + G  + +  G S F L   P  +FP 
Sbjct: 61  VSRPGATTAPAHTFYEIVRKLPDGSQVEIEHDADTGL-MTLRSGRSKFTLSCLPVEDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK--LCAVATDG 178
               E  ++F L ++ LK LV+RT FA++TEE RYYLNGI+ H         L AVATDG
Sbjct: 120 LSGGELPFTFCLTAAELKALVDRTRFAISTEETRYYLNGIYLHAATTPGGEVLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  EV +    A MP +I+PRK V E+ +++   +  V VSLSE+++        ++
Sbjct: 180 HRLARVEVTLPEGAAGMPGVIIPRKTVQEMRKLIDETEGEVTVSLSETKLRFAFADAVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y+ VIP  NDK+L V+  +  QAVDRVS +S+ + +A+KLSL    + ++
Sbjct: 240 SKLIDGTFPDYERVIPADNDKQLDVDVKSFAQAVDRVSAISTEKSRAIKLSLEKGTVTLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
             +P+ G A E +   Y   P++I FN +YLL+I+  +       D+  F +  + S   
Sbjct: 300 ASSPENGSATEEIEAQYESTPLEIGFNSRYLLDILGQVEG-----DKACFSMADAASPTV 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R    D  N       A YVLMPMR+
Sbjct: 355 VR----DGVN-----AGAIYVLMPMRV 372


>gi|319898310|ref|YP_004158403.1| DNA polymerase III, beta chain [Bartonella clarridgeiae 73]
 gi|319402274|emb|CBI75813.1| DNA polymerase III, beta chain [Bartonella clarridgeiae 73]
          Length = 373

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 153/387 (39%), Positives = 239/387 (61%), Gaps = 16/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+I + RS +L+ L    R++ER+N IP+  +VL+ A+ G +++KA+  ++E+  +   +
Sbjct: 1   MRIIIGRSQLLKSLSRVHRVVERRNAIPILSNVLIDASSGGMQLKATDLDLEVIESSSVN 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           ++  G+ITV AHLLYDIVRKL D +++    +    + ++++ G +NF LQ  P+ +FP 
Sbjct: 61  IEKAGAITVPAHLLYDIVRKLPDDSEVILEVDENQPSTMSVTSGCANFRLQCLPKVDFPE 120

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDL-KLCAVATDGH 179
           +   ++   F L +S LK L++ T FAM+TEE RYYLNGI+FHI ++   KL  V+TDGH
Sbjct: 121 SLPGQFSCRFSLLASRLKYLLDCTQFAMSTEETRYYLNGIYFHIIDDGTSKLRLVSTDGH 180

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSK-DSSVKVSLSESRIHLNIESLSMS 238
           RLA  +++  +    MP +I+PRK VGE+ ++L  + D+ V + LS+++I  ++ S+ ++
Sbjct: 181 RLAQVDIEAPSGAGGMPGVIIPRKTVGELQKLLGEEADNDVCIELSDTKIRFSVGSVILT 240

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP YQ VIP  NDK+L +N  +   AVDRVS +SS R  AVKL++    L   
Sbjct: 241 SKLIDGVFPEYQRVIPLGNDKKLVINRQDFSSAVDRVSTISSDRGCAVKLTIEKGLLRFV 300

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NPD G A + +   Y    ++I FN +YLL+I   ISS      E++F L    +   
Sbjct: 301 VNNPDSGSAEDQLVADYASDLLEIGFNSRYLLDIAAQISS-----HEMIFMLADPGAPAL 355

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           IRG         +   NA YVLMP+R+
Sbjct: 356 IRG---------NGDTNALYVLMPIRV 373


>gi|23006928|ref|ZP_00049021.1| COG0592: DNA polymerase sliding clamp subunit (PCNA homolog)
           [Magnetospirillum magnetotacticum MS-1]
          Length = 328

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 149/328 (45%), Positives = 207/328 (63%), Gaps = 5/328 (1%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++TVER+ +L  LGH  R++ER+NTIP+  +VLL+  +  L +KA+  +IE+T  +PA 
Sbjct: 1   MRVTVERAALLRSLGHVHRVVERRNTIPILSNVLLRTGEDGLRLKATDLDIEVTETVPAD 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V   G+ TV AH++YDIVRKL +GAQ+S     + G ++ I  G S F L + PE +FP 
Sbjct: 61  VLDAGATTVPAHVIYDIVRKLPEGAQVSLETSGDTG-QMTIRSGRSRFALGALPEGDFPD 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
               E  +SF +A++ LK L+E+T FA++TEE RYYLNGI+ H  E D  LKL AVATDG
Sbjct: 120 LAAGELPHSFSIAAAELKLLIEKTQFAISTEETRYYLNGIYLHTVEVDGALKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIE-SLSM 237
           HRLA  E         MP IIVPRKAV EI +++     SV+V LS ++I L     +++
Sbjct: 180 HRLARVETAAPEGSRGMPGIIVPRKAVAEIQKLVDDGGESVQVELSPAKIRLTFAGGVTL 239

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
             +LIDG FP+YQ VIP  NDK L V      +AVDRVS +SS R +AVKL+++  ++ +
Sbjct: 240 ISKLIDGTFPDYQRVIPSGNDKHLTVVRDAFAKAVDRVSTISSERGRAVKLAMADGRVAL 299

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFN 325
           +V NPD G   E+         +DI F 
Sbjct: 300 SVTNPDAGSRTENSTSITRPW-LDIGFK 326


>gi|254465740|ref|ZP_05079151.1| DNA polymerase III, beta subunit [Rhodobacterales bacterium Y4I]
 gi|206686648|gb|EDZ47130.1| DNA polymerase III, beta subunit [Rhodobacterales bacterium Y4I]
          Length = 373

 Score =  280 bits (716), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 150/388 (38%), Positives = 235/388 (60%), Gaps = 18/388 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKI++ER  +L+ +  A  ++ER+NTIP+  +VL++A    ++ +A+  +IE+    PA 
Sbjct: 1   MKISIERGTLLKAVAQAQSVVERRNTIPILANVLIEAEGDSVQFRATDLDIEVVDKAPAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV+A  L++IVRKL DGA ++   +   G  + +  G SNF L + P  +FP 
Sbjct: 61  VERAGATTVAATTLHEIVRKLPDGALVTLTADAATG-RLAVEAGRSNFSLATLPREDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHIN---EEDLKLCAVATD 177
               EY  +F   ++VL+ L +++ FA++TEE RYYLNG++ H+    E    L AVATD
Sbjct: 120 MASSEYHSNFAAKAAVLRRLFDKSKFAISTEETRYYLNGVYLHVANGAEGGKALRAVATD 179

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLA  + ++      MP +IVPRK VGE+ ++L   D  + VS+SE+++     ++++
Sbjct: 180 GHRLARIDAELPLGAEDMPGVIVPRKTVGELRKLLDEDDMDIAVSVSETKVRFATPNITL 239

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + ++IDG FP+Y  VIP  N + L V+     QAVDRV+ +SS R +AVKL L  D+L +
Sbjct: 240 TSKVIDGTFPDYTRVIPAGNTRRLEVDAAEFAQAVDRVATVSSERSRAVKLQLEEDRLIL 299

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           +V+ PD G A E + V YN+  ++I FN KYLLEI     +++V  +  VF  +SS    
Sbjct: 300 SVNAPDSGAAEEELAVAYNDERLEIGFNAKYLLEI-----ANQVDRENAVFMFNSSGDPT 354

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            +R         + N  +A YV+MPMR+
Sbjct: 355 LMR---------EGNDESAVYVVMPMRV 373


>gi|56551876|ref|YP_162715.1| DNA polymerase III subunit beta [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241761806|ref|ZP_04759892.1| DNA polymerase III, beta subunit [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|56543450|gb|AAV89604.1| DNA polymerase III, beta subunit [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241373720|gb|EER63280.1| DNA polymerase III, beta subunit [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
          Length = 369

 Score =  279 bits (714), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 147/386 (38%), Positives = 235/386 (60%), Gaps = 18/386 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQA-NDGLLEIKASGPEIEITGAIPA 59
           MK T+ER+ +L+ L H   ++ER+NTIP+  +VL++A ++G +++ A+  ++++   + A
Sbjct: 1   MKATIERATLLKSLSHVQSVVERRNTIPILSNVLIEAASNGCVKLMATDLDLQVVETLSA 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            VD  G  TVSAH+L++IVRKL DG+QI     +    ++ I  G S F L + P  +FP
Sbjct: 61  EVDTPGETTVSAHMLFEIVRKLPDGSQIQLSAAD---GKMLIVAGRSRFSLATLPRDDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
              E E    F L +  LK ++++T FA++ +E RYYLNGIF H+ +++  + A ATDGH
Sbjct: 118 VISESELPTHFALPTESLKQIIDKTRFAISVDETRYYLNGIFLHVLKDENVMKAAATDGH 177

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA   +   A    MP +I+PRK V E+ ++L   +  +K+SLS S+I  ++    ++ 
Sbjct: 178 RLACVTIPAPAGAEDMPDVIIPRKCVVELRKLLDECEDEIKISLSASKICFDLGHAILTS 237

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +LIDG FP+Y  VIP +NDK L+V   +L Q VDRV+ ++S + +AVK+S+ + K+ ++V
Sbjct: 238 KLIDGTFPDYSRVIPTANDKLLKVKPKDLMQGVDRVATIASEKTRAVKMSIEAGKISLSV 297

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
            +P+ G A E +   Y+  P+DI FN +YLL+I+  I S     D+    L  + +   I
Sbjct: 298 TSPENGMATEEVLGEYDADPLDIGFNARYLLDILGQIES-----DQAEIHLAEAAAPTLI 352

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           R  D+ +         A YVLMPMR+
Sbjct: 353 RDSDQSA---------ALYVLMPMRV 369


>gi|85374293|ref|YP_458355.1| DNA polymerase III subunit beta [Erythrobacter litoralis HTCC2594]
 gi|84787376|gb|ABC63558.1| DNA polymerase III beta subunit [Erythrobacter litoralis HTCC2594]
          Length = 375

 Score =  279 bits (714), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 158/393 (40%), Positives = 232/393 (59%), Gaps = 26/393 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDG-LLEIKASGPEIEITGAI-P 58
           MK T+ER+ +L  L H   ++ER+NTIP+  ++L++A DG  +++ A+  ++++   +  
Sbjct: 1   MKATIERATLLRCLSHVQSVVERRNTIPILSNILIEAGDGSAVKVMATDLDLQVVETMNA 60

Query: 59  ASVDVCGSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESE 117
           ASV+  GS TVSAHLL+DI RKL DG+Q+S    +N +     I  G S F L + P+ +
Sbjct: 61  ASVESSGSTTVSAHLLFDIARKLPDGSQVSLEVADNRM----TIKAGRSRFQLPTLPKDD 116

Query: 118 FPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK-LCAVAT 176
           FP   E +   SFE+ +  L  L++RT FA++TEE RYYLNGIF H+++ED   L A AT
Sbjct: 117 FPVIVEGDLPTSFEIPAKTLAELIDRTRFAISTEETRYYLNGIFLHVSDEDTPVLKAAAT 176

Query: 177 DGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSK-DSSVKVSLSESRIHLNIESL 235
           DGHRLA   +        MP +IVPRKAVGE+ ++L  + D +V V LS S+I   +   
Sbjct: 177 DGHRLARFTLARPDGADGMPDVIVPRKAVGELRKLLEERMDGNVVVDLSASKIRFTLGGE 236

Query: 236 SMSV---RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSS 292
             +V   +LIDG FP+Y  VIP  NDK L+V+  +  + VDRV+ +++ + +AVK+ L +
Sbjct: 237 GGTVLTSKLIDGTFPDYSRVIPTGNDKLLKVDPKSFFEGVDRVATIATEKTRAVKMGLDA 296

Query: 293 DKLCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDS 352
           DK+ ++V +PD G A E +   Y     +I FN  YL +I+  I S     D V   L  
Sbjct: 297 DKVTLSVTSPDNGTASEELAAEYKSEGFEIGFNANYLKDILSQIDS-----DMVELHLAD 351

Query: 353 SNSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +   IR         KD    A YVLMPMR+
Sbjct: 352 AGAPTLIR---------KDENSPALYVLMPMRV 375


>gi|89052493|ref|YP_507944.1| DNA polymerase III subunit beta [Jannaschia sp. CCS1]
 gi|88862042|gb|ABD52919.1| DNA polymerase III, beta subunit [Jannaschia sp. CCS1]
          Length = 372

 Score =  279 bits (713), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 146/387 (37%), Positives = 231/387 (59%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+++ER+ +L  +  A  ++ER+NTIP+  +VL++A    +  +A+  +IE+    PA 
Sbjct: 1   MKLSIERATLLRAVSQAQSVVERRNTIPILANVLIEAEGETVSFRATDLDIEVVDKAPAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TVSA  L++IVRKL DG+ +S   E+   + + I  G S+F L + P  +FP 
Sbjct: 61  VERAGATTVSAVTLHEIVRKLPDGSLVSL-TEDTTTSRLTIEAGRSSFQLATLPREDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
               +Y  +F   +  L+ L +++ FA++TEE RYYLNG++FHI E D    L AVATDG
Sbjct: 120 MASTDYAANFSAKAPELRRLFDKSKFAISTEETRYYLNGVYFHIAEGDNGKALRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  +  +     +MP +IVPRK VGE+ ++L   D+ + VS+SE++I      ++++
Sbjct: 180 HRLARIDSALPDGAQEMPGVIVPRKTVGELRKLLDDDDAQIAVSVSETKIRFATPDITLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  N + + V+  +  +AVD V+ +SS R +AVK++L  D+L ++
Sbjct: 240 SKVIDGTFPDYTRVIPAGNTRRMEVDAGDFAKAVDLVATVSSERSRAVKMALDEDRLMLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A   + V Y +  ++I FN KYLLEI     + +V  +  VF   S      
Sbjct: 300 VNAPDSGNAEAELVVAYADEKLEIGFNAKYLLEI-----ASQVDRENAVFMFSSPAEPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R  + DS         A YV+MPMR+
Sbjct: 355 MREGNDDS---------AIYVVMPMRV 372


>gi|260752565|ref|YP_003225458.1| DNA polymerase III subunit beta [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258551928|gb|ACV74874.1| DNA polymerase III, beta subunit [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 369

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 146/386 (37%), Positives = 234/386 (60%), Gaps = 18/386 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQA-NDGLLEIKASGPEIEITGAIPA 59
           MK T+ER+ +L+ L H   ++ER+NTIP+  +VL++A ++G +++ A+  ++++   + A
Sbjct: 1   MKATIERATLLKSLSHVQSVVERRNTIPILSNVLIEAASNGCVKLMATDLDLQVVETLSA 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            VD  G  TVSAH+L++IVRKL DG+QI     +    ++ I  G S F L + P  +FP
Sbjct: 61  EVDTPGETTVSAHMLFEIVRKLPDGSQIQLSAAD---GKMLIVAGRSRFSLATLPRDDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
              E E    F L +  LK ++++T FA++ +E RYYLNGIF H+ +++  + A ATDGH
Sbjct: 118 VISESELPTHFALPTESLKQIIDKTRFAISVDETRYYLNGIFLHVLKDENVMKAAATDGH 177

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA   +        MP +I+PRK V E+ ++L   +  +K+SLS S+I  ++    ++ 
Sbjct: 178 RLACVTIPAPVGAEDMPDVIIPRKCVVELRKLLDECEDEIKISLSASKICFDLGHAILTS 237

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +LIDG FP+Y  VIP +NDK L+V   +L Q VDRV+ ++S + +AVK+S+ + K+ ++V
Sbjct: 238 KLIDGTFPDYSRVIPTANDKLLKVKPKDLMQGVDRVATIASEKTRAVKMSIEAGKISLSV 297

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
            +P+ G A E +   Y+  P+DI FN +YLL+I+  I S     D+    L  + +   I
Sbjct: 298 TSPENGMATEEVLGEYDADPLDIGFNARYLLDILGQIES-----DQAEIHLAEAAAPTLI 352

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           R  D+ +         A YVLMPMR+
Sbjct: 353 RDSDQSA---------ALYVLMPMRV 369


>gi|254439754|ref|ZP_05053248.1| DNA polymerase III, beta subunit [Octadecabacter antarcticus 307]
 gi|198255200|gb|EDY79514.1| DNA polymerase III, beta subunit [Octadecabacter antarcticus 307]
          Length = 372

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 147/387 (37%), Positives = 233/387 (60%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKI++ER+ +L+ +  A  ++ER+NTIP+  +VL++A+      +A+  +IE+     A 
Sbjct: 1   MKISIERASLLKAVAQAQSVVERRNTIPILANVLIEASGDEATFRATDLDIEVVDKATAV 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TVSA  L +IVRKL DGA ++   ++  G  + I  G SNF L + P+ +FP 
Sbjct: 61  VERAGATTVSAVTLNEIVRKLPDGALVTLTDDSASG-RLTIEAGRSNFSLATLPKEDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK--LCAVATDG 178
               +Y  +F   + VL+ L +++ FA++TEE RYYLNG++ H++E D    L  VATDG
Sbjct: 120 MASSDYATNFSCPAPVLRRLFDKSKFAISTEETRYYLNGVYMHVSESDGGKVLRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  +  +      M  +IVPRK VGE+ ++L   D  + VS+SE++I      ++++
Sbjct: 180 HRLARIDAALPEGADGMAGVIVPRKTVGELRKLLDDDDMMIAVSVSETKIRFATPDITLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP +N +++ V+     +AVDRV+ +SS R +AVKL L  D+L ++
Sbjct: 240 SKVIDGTFPDYTRVIPQNNTRKMEVDAAEFARAVDRVATVSSERSRAVKLQLDEDRLILS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E ++V Y +  ++I FN KYLLEI     + +V  +  VF  +SS     
Sbjct: 300 VNAPDSGAAEEELSVAYGDERLEIGFNAKYLLEI-----ASQVDRENAVFMFNSSGDPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         + N  +A YV+MPMR+
Sbjct: 355 MR---------EGNDTSAIYVVMPMRV 372


>gi|296285052|ref|ZP_06863050.1| DNA polymerase III subunit beta [Citromicrobium bathyomarinum
           JL354]
          Length = 375

 Score =  276 bits (706), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 156/392 (39%), Positives = 230/392 (58%), Gaps = 24/392 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQAN-DGLLEIKASGPEIEITGAI-P 58
           MK T+ER+ +L  L H   ++ER+NTIP+  +VL+ A+  G +++ A+  ++++   +  
Sbjct: 1   MKATIERATLLRCLSHVQSVVERRNTIPILSNVLIDADAGGGVKVMATDLDLQVVETMTA 60

Query: 59  ASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEF 118
           ASV+  G+ITVSAHLL+DI RKL DG+Q+S    +     + +  G S F L + P  +F
Sbjct: 61  ASVESAGAITVSAHLLFDIARKLPDGSQVSLETAD---NRMVVKAGRSRFQLPTLPRDDF 117

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK-LCAVATD 177
           P   E E   SFEL +  L  +++RT FA++TEE RYYLNGIF H+++E    L A ATD
Sbjct: 118 PVIVEGELPTSFELPARELAEMIDRTRFAISTEETRYYLNGIFLHVSDEARPVLKAAATD 177

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSK-DSSVKVSLSESRIHLNIES-- 234
           GHRLA   +D       MP +IVPRKAVGE+ ++L    DS+V++ LS S+I   +    
Sbjct: 178 GHRLARYTLDRPEGAEGMPDVIVPRKAVGELRKLLEEALDSNVQIDLSASKIRFALGGEG 237

Query: 235 -LSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSD 293
            + ++ +LIDG FP+Y  VIP  NDK LR++     Q VDRV+ +++ + +AVK+ L  D
Sbjct: 238 GVVLTSKLIDGTFPDYSRVIPTGNDKLLRLDPKAFFQGVDRVATIATEKTRAVKMGLDED 297

Query: 294 KLCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSS 353
           K+ ++V +PD G A E +   Y     +I FN  YL +I+  I S     D V   L  +
Sbjct: 298 KVTLSVTSPDNGTAAEEIAAEYKAEGFEIGFNANYLKDILGQIDS-----DTVELHLADA 352

Query: 354 NSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            +   IR         +D    A YVLMPMR+
Sbjct: 353 GAPTLIR---------RDENSPALYVLMPMRV 375


>gi|114769643|ref|ZP_01447253.1| DNA polymerase III subunit beta [alpha proteobacterium HTCC2255]
 gi|114549348|gb|EAU52230.1| DNA polymerase III subunit beta [alpha proteobacterium HTCC2255]
          Length = 372

 Score =  276 bits (705), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 146/387 (37%), Positives = 229/387 (59%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+++ERS +L+ +  A  ++ER+NTIP+  +VL++A  G +  +A+  +IE+   +   
Sbjct: 1   MKVSIERSALLKAMSQAQSVVERRNTIPILANVLIEAEGGEISFRATDLDIEVVYKVVGM 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AH L++IVRKL DGA +    ++     +++  G S+F L + P  +FP 
Sbjct: 61  VERAGATTVGAHTLHEIVRKLPDGAMVEL-TDDATANRLDVVAGRSSFSLATLPREDFPI 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHIN--EEDLKLCAVATDG 178
               EY  +F   S  L+ L +++ FA++TEE RYYLNG++ H +  E    L  VATDG
Sbjct: 120 MANSEYACNFSAQSETLRRLFDKSKFAISTEETRYYLNGVYMHSSDGENGRVLRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  +  +      +P +IVPRK VGE+ ++L   +  + VS+SE++I  +   + ++
Sbjct: 180 HRLARIDTQLPEGADTLPGVIVPRKTVGELRKLLDDDEMKIAVSVSETKIRFSTPEIILT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  N + L V+     QAVDRVS +SS R +AVKL+L  D+L ++
Sbjct: 240 SKVIDGSFPDYTRVIPQGNTRRLEVDAAEFAQAVDRVSTVSSERSRAVKLTLEDDRLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V Y +  ++I FN KYLLEI     + +V  +  VF  +SS     
Sbjct: 300 VNAPDSGAAEEELVVAYADERLEIGFNAKYLLEI-----AGQVDRENAVFMFNSSGDPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         + N  +A YV+MPMR+
Sbjct: 355 MR---------EGNDESAVYVVMPMRV 372


>gi|254451638|ref|ZP_05065075.1| DNA polymerase III, beta subunit [Octadecabacter antarcticus 238]
 gi|198266044|gb|EDY90314.1| DNA polymerase III, beta subunit [Octadecabacter antarcticus 238]
          Length = 372

 Score =  276 bits (705), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 145/387 (37%), Positives = 234/387 (60%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+++ER+ +L+ +  A  ++ER+NTIP+  +VL++A+      +A+  +IE+     A 
Sbjct: 1   MKLSIERASLLKAVAQAQSVVERRNTIPILANVLIEASGAEATFRATDLDIEVVDKATAV 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  GS TVSA  L +IVRKL DGA ++  +++  G  + I  G SNF L + P+ +FP 
Sbjct: 61  VERAGSTTVSAVTLNEIVRKLPDGALVTLTEDSASG-RLTIEAGRSNFSLATLPKEDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK--LCAVATDG 178
               +Y  +F   + VL+ L +++ FA++TEE RYYLNG++ H++E D    L  VATDG
Sbjct: 120 MASSDYATNFSCPAPVLRRLFDKSKFAISTEETRYYLNGVYMHVSESDGGKVLRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  +  +      M  +IVPRK VGE+ ++L   +  + VS+SE+++      ++++
Sbjct: 180 HRLARIDAALPEGADGMAGVIVPRKTVGELRKLLDDDEMMIAVSVSETKVRFATPDITLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP +N +++ V+     +AVDRV+ +SS R +AVKL L  D+L ++
Sbjct: 240 SKVIDGTFPDYTRVIPQNNTRKMEVDAAEFARAVDRVATVSSERSRAVKLQLDEDRLILS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E ++V Y +  ++I FN KYLLEI     + +V  +  VF  +SS     
Sbjct: 300 VNAPDSGAAEEELSVAYGDERLEIGFNAKYLLEI-----ASQVDRENAVFMFNSSGDPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         + N  +A YV+MPMR+
Sbjct: 355 MR---------EGNDTSAIYVVMPMRV 372


>gi|297184289|gb|ADI20406.1| DNA polymerase sliding clamp subunit (pcna homolog) [uncultured
           alpha proteobacterium EB080_L43F08]
          Length = 372

 Score =  276 bits (705), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 146/387 (37%), Positives = 229/387 (59%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+++ERS +L+ +  A  ++ER+NTIP+  +VL++A  G +  +A+  +IE+   +   
Sbjct: 1   MKVSIERSALLKAMSQAQSVVERRNTIPILANVLIEAEGGEISFRATDLDIEVVYKVVGM 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV AH L++IVRKL DGA +    ++     +++  G S+F L + P  +FP 
Sbjct: 61  VERAGATTVGAHTLHEIVRKLPDGAMVEL-TDDATANRLDVVAGRSSFSLATLPREDFPI 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHIN--EEDLKLCAVATDG 178
               EY  +F   S  L+ L +++ FA++TEE RYYLNG++ H +  E    L  VATDG
Sbjct: 120 MANSEYACNFSAQSETLRRLFDKSKFAISTEETRYYLNGVYMHSSDGENGRVLRCVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  +  +      +P +IVPRK VGE+ ++L   +  + VS+SE++I  +   + ++
Sbjct: 180 HRLARIDTQLPEGADTLPGVIVPRKTVGELRKLLDDDEMKIAVSVSETKIRFSTPEIILT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  N + L V+     QAVDRVS +SS R +AVKL+L  D+L ++
Sbjct: 240 SKVIDGSFPDYTRVIPQGNTRRLEVDAAEFAQAVDRVSTVSSERSRAVKLTLEDDRLVLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+ PD G A E + V Y +  ++I FN KYLLEI     + +V  +  VF  +SS     
Sbjct: 300 VNAPDSGAAEEELVVGYADERLEIGFNAKYLLEI-----AGQVDRENAVFMFNSSGDPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         + N  +A YV+MPMR+
Sbjct: 355 MR---------EGNDESAVYVVMPMRV 372


>gi|310816810|ref|YP_003964774.1| DNA polymerase III, beta subunit [Ketogulonicigenium vulgare Y25]
 gi|308755545|gb|ADO43474.1| DNA polymerase III, beta subunit [Ketogulonicigenium vulgare Y25]
          Length = 372

 Score =  275 bits (704), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 144/387 (37%), Positives = 232/387 (59%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK ++ERS +L+ +  A  ++ER+N IP+  +VL+ A    ++ +A+  +IE+  +  A 
Sbjct: 1   MKFSIERSALLKAVAQAQSVVERRNAIPILSNVLIAAEGAAVQFRATDLDIEVQDSAVAM 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV+A +L +IVRKL DGA ++   +      + I+ G S F L + P+ +FP+
Sbjct: 61  VEQAGAATVNAAMLNEIVRKLPDGALVAITYDPS-AERLTIAAGRSTFTLATLPQQDFPA 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATDG 178
               ++  SF   + +L+ L +++ FA++TEE RYYLNG++FHI   EE   L AVATDG
Sbjct: 120 MASADFEASFTAPAPLLRRLFDKSKFAISTEETRYYLNGVYFHIATGEEGPVLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  +  +    A MP +IVPRK VGE+ ++L   ++ + VS+SE++I     +++++
Sbjct: 180 HRLARIDAPLPDGAAGMPGVIVPRKTVGELRKLLDDDNALIAVSVSETKIRFATPNITLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  N + L V+     +AVDRV+ +SS R +AVKL+L  D+L ++
Sbjct: 240 SKVIDGTFPDYTRVIPTGNTRRLEVDAAEFAKAVDRVATVSSERSRAVKLALEDDRLLLS 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V +PD G A E + V Y +  ++I FN KYL EI     + +V  +  VF L+       
Sbjct: 300 VQSPDTGAAEEELVVAYADERLEIGFNAKYLQEI-----AAQVDRENAVFMLNGPGDPAL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +R         +    +A YV+MPMR+
Sbjct: 355 MR---------EGGDTSAVYVVMPMRV 372


>gi|260431697|ref|ZP_05785668.1| DNA polymerase III, beta subunit [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260415525|gb|EEX08784.1| DNA polymerase III, beta subunit [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 373

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 148/388 (38%), Positives = 236/388 (60%), Gaps = 18/388 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKI++ER  +L+ +  A  ++ER+NTIP+  +VL++A    +  +A+  +IE+    PA 
Sbjct: 1   MKISIERGTLLKAVSQAQSVVERRNTIPILANVLIEAEGDQVLFRATDLDIEVVDKAPAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV+A  L++IVRKL DGA ++   ++  G  + +  G SNF L + P+ +FP 
Sbjct: 61  VEKAGATTVAATTLHEIVRKLPDGALVTLTADSAAG-RLTVEAGRSNFSLATLPKEDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHIN---EEDLKLCAVATD 177
               EY  +F  ++++L+ L +++ FA++TEE RYYLNG++ H+    E    L  VATD
Sbjct: 120 MASSEYQSNFTASAALLRRLFDKSKFAISTEETRYYLNGVYMHVADGPEGGKVLRCVATD 179

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLA  + D+ A    MP +IVPRK VGE+ ++L   D  + VS+SE+++      +++
Sbjct: 180 GHRLARIDADLPAGAEDMPGVIVPRKTVGELRKLLEDDDMDIAVSVSETKVRFATPDITL 239

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + ++IDG FP+Y  VIP +N ++L V+     QAVDRV+ +SS R +AVKL L +DKL +
Sbjct: 240 TSKVIDGTFPDYTRVIPQNNTRKLEVDAAEFAQAVDRVATVSSERSRAVKLQLENDKLVL 299

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           +V+ PD G A E + V Y +  ++I FN KYL EI     + +V  +  VF  +S+    
Sbjct: 300 SVNAPDSGAAEEELAVAYGDERLEIGFNAKYLQEI-----ASQVDRENAVFLFNSAGDPT 354

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            +R         + N  +A YV+MPMR+
Sbjct: 355 LMR---------EGNDQSAVYVVMPMRV 373


>gi|149184745|ref|ZP_01863063.1| DNA polymerase III subunit beta [Erythrobacter sp. SD-21]
 gi|148832065|gb|EDL50498.1| DNA polymerase III subunit beta [Erythrobacter sp. SD-21]
          Length = 374

 Score =  273 bits (699), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 153/392 (39%), Positives = 229/392 (58%), Gaps = 25/392 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAI-PA 59
           MK T+ER+ +L  L H   ++ER+NTIP+  +VL++A    L + A+  ++++   I  A
Sbjct: 1   MKATIERATLLRCLSHVQSVVERRNTIPILSNVLIEAEGNGLRVMATDLDLQVVEHIEAA 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESEF 118
           SV+  G+ITVSAHLL+DI RKL +G+Q+S    EN +    ++  G S F L + P  +F
Sbjct: 61  SVESDGAITVSAHLLFDIARKLPEGSQVSLETAENRM----DVKAGRSRFKLPTLPRDDF 116

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK-LCAVATD 177
           P   E +   SF L +  L  +++RT FA++TEE RYYLNGIF H+++ED   L A ATD
Sbjct: 117 PMIVEGDLPTSFSLPAKTLAEMIDRTRFAISTEETRYYLNGIFLHVSDEDQPVLKAAATD 176

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSK-DSSVKVSLSESRIHLNIES-- 234
           GHRLA   +        MP +IVPRKAV E+ ++L  K D  V++ LS S+I   +    
Sbjct: 177 GHRLARFTLARPEGAEGMPDVIVPRKAVAELRKLLDEKMDGDVQIDLSASKIRFTLGGEG 236

Query: 235 -LSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSD 293
            + ++ +LIDG FP+Y  VIP  NDK L+++  +    VDRV+ +++ + +AVK+ L  D
Sbjct: 237 GVVLTSKLIDGTFPDYSRVIPTGNDKLLKIDPKSFFAGVDRVATIATEKTRAVKMGLDKD 296

Query: 294 KLCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSS 353
           ++ +TV +PD G A E +   Y     +I FN  YL +I+  I S     D+V   L  +
Sbjct: 297 RVTLTVTSPDNGTASEELAAEYGSDGFEIGFNAGYLKDILSQIDS-----DQVEIHLADA 351

Query: 354 NSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            +   IR         K++   A YVLMPMR+
Sbjct: 352 GAPTLIR---------KNDDSPALYVLMPMRV 374


>gi|114568556|ref|YP_755236.1| DNA polymerase III subunit beta [Maricaulis maris MCS10]
 gi|114339018|gb|ABI64298.1| DNA polymerase III, beta subunit [Maricaulis maris MCS10]
          Length = 372

 Score =  273 bits (699), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 150/387 (38%), Positives = 225/387 (58%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+T+ER+ +L+ LGH   ++E++NTIP+  +VL+ A        A+  +IEI     AS
Sbjct: 1   MKLTIERATLLKALGHVQAVVEKRNTIPILSNVLISAGPDGASFAATDLDIEILETTDAS 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
            D  G +T  AH LYDI RKL DGA ++  + N     + +  G S+F L S P  +FP 
Sbjct: 61  CDGEGLVTAPAHTLYDITRKLPDGADVTL-EMNGSDPRLTLKAGRSSFSLPSLPPGDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK--LCAVATDG 178
              E+  + F++ +  L  L+++T FA++TEE RYYLNGI  H  ++D +  L AVATDG
Sbjct: 120 MPTEDLEHRFQVPARELARLIDKTRFAISTEETRYYLNGIHLHAADQDGRKTLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
            RLA+AEVD+      MP +IVPRK V E+ R+L   D  V+VS+SE +I   +    ++
Sbjct: 180 VRLALAEVDLPDGADGMPGVIVPRKTVQEVKRLLEDADDDVEVSVSEGKIRFRLGRAVLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y+ VIP  N + + V      +AVDRV+ +S  + ++VKLSL +D L + 
Sbjct: 240 SKLIDGAFPDYERVIPRGNTRLMSVENKRFAEAVDRVATISVEKSRSVKLSLGADALTLA 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V+NP+ G+A E + V Y++    I FN +Y+L++   I       DE  F    + S   
Sbjct: 300 VNNPESGQAEEELAVSYSDEGFAIGFNARYMLDVASQIEG-----DEARFHFADAASPAL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +     DS +      +A YVLMP+R+
Sbjct: 355 V----TDSGDP-----DALYVLMPLRV 372


>gi|254510311|ref|ZP_05122378.1| DNA polymerase III, beta subunit [Rhodobacteraceae bacterium KLH11]
 gi|221534022|gb|EEE37010.1| DNA polymerase III, beta subunit [Rhodobacteraceae bacterium KLH11]
          Length = 373

 Score =  273 bits (697), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 147/388 (37%), Positives = 236/388 (60%), Gaps = 18/388 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKI++ER  +L+ +  A  ++ER+NTIP+  +VL++A       +A+  +IE+    PA 
Sbjct: 1   MKISIERGTLLKAVSQAQSVVERRNTIPILANVLIEAEGDQALFRATDLDIEVVDKAPAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV+A  L++IVRKL DGA ++   ++  G  + +  G SNF L + P+ +FP 
Sbjct: 61  VEKAGATTVAATTLHEIVRKLPDGALVTLTADSAAG-RLTVEAGRSNFSLATLPKEDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI---NEEDLKLCAVATD 177
               EY  +F  ++++L+ L +++ FA++TEE RYYLNG++ H+   ++    L  VATD
Sbjct: 120 MASSEYQSNFTASAALLRRLFDKSKFAISTEETRYYLNGVYMHVADGSDGGKVLRCVATD 179

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLA  + D+    A +P +IVPRK VGE+ ++L   +  + VS+SE++I      +++
Sbjct: 180 GHRLARIDADLPDGAADLPGVIVPRKTVGELRKLLDDDEMDIAVSVSETKIRFATPDITL 239

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + ++IDG FP+Y  VIP  N ++L V+     QAVDRV+ +SS R +AVKL L +DKL +
Sbjct: 240 TSKVIDGTFPDYTRVIPQGNTRKLEVDAAEFAQAVDRVATVSSERSRAVKLQLDADKLVL 299

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           +V+ PD G A E + V Y +  ++I FN KYLLEI     + +V  +  VF  +S+    
Sbjct: 300 SVNAPDSGAAEEELAVAYGDERLEIGFNAKYLLEI-----ASQVDRENAVFMFNSAGDPT 354

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            +R         + N  +A YV+MPMR+
Sbjct: 355 LMR---------EGNDQSAVYVVMPMRV 373


>gi|163743747|ref|ZP_02151121.1| DNA polymerase III subunit beta [Phaeobacter gallaeciensis 2.10]
 gi|161383008|gb|EDQ07403.1| DNA polymerase III subunit beta [Phaeobacter gallaeciensis 2.10]
          Length = 373

 Score =  271 bits (693), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 147/389 (37%), Positives = 236/389 (60%), Gaps = 20/389 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKI++ER  +L+ +  A  ++ER+NTIP+  +VL++A   +++ +A+  +IE+    PA 
Sbjct: 1   MKISIERGTLLKAVAQAQSVVERRNTIPILANVLIEAEGDIVQFRATDLDIEVVDKAPAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV+A  L++IVRKL DGA ++   +   G  + +  G SNF L + P  +FP 
Sbjct: 61  VERAGATTVAATTLHEIVRKLPDGALVTLTADAASG-RLTVEAGRSNFSLATLPREDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHIN---EEDLKLCAVATD 177
               EY  +F   ++VL+ L +++ FA++TEE RYYLNG++ H+    E    L  VATD
Sbjct: 120 MASSEYHSNFTANAAVLQRLFDKSKFAISTEETRYYLNGVYMHVADGVEGGKALRCVATD 179

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLA  + ++      MP +IVPRK VGE+ ++L   +  + VS+SE+++     ++++
Sbjct: 180 GHRLARIDANLPMGAEDMPGVIVPRKTVGELRKLLDDDEMDIAVSVSETKVRFATPNITL 239

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + ++IDG FP+Y  VIP  N + L V+ +   +AVDRV+ +SS R +AVKL L  D+L +
Sbjct: 240 TSKVIDGTFPDYTRVIPAGNTRRLEVDASEFARAVDRVATVSSERSRAVKLQLDEDRLIL 299

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           +V+ PD G A E + V Y +  ++I FN KYLLEI     +++V  +  VF  +SS    
Sbjct: 300 SVNAPDSGAAEEELAVAYRDERLEIGFNAKYLLEI-----ANQVDRENAVFMFNSSGDPT 354

Query: 358 FIR-GKDKDSKNNKDNKVNAFYVLMPMRI 385
            +R G D+          +A YV+MPMR+
Sbjct: 355 LMREGSDE----------SAVYVVMPMRV 373


>gi|163738135|ref|ZP_02145551.1| DNA polymerase III subunit beta [Phaeobacter gallaeciensis BS107]
 gi|161388751|gb|EDQ13104.1| DNA polymerase III subunit beta [Phaeobacter gallaeciensis BS107]
          Length = 373

 Score =  271 bits (693), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 147/389 (37%), Positives = 236/389 (60%), Gaps = 20/389 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKI++ER  +L+ +  A  ++ER+NTIP+  +VL++A   +++ +A+  +IE+    PA 
Sbjct: 1   MKISIERGTLLKAVAQAQSVVERRNTIPILANVLIEAEGDIVQFRATDLDIEVVDKAPAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV+A  L++IVRKL DGA ++   +   G  + +  G SNF L + P  +FP 
Sbjct: 61  VERAGATTVAATTLHEIVRKLPDGALVTLTADAASG-RLTVEAGRSNFSLATLPREDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHIN---EEDLKLCAVATD 177
               EY  +F   ++VL+ L +++ FA++TEE RYYLNG++ H+    E    L  VATD
Sbjct: 120 MASSEYHSNFSANAAVLQRLFDKSKFAISTEETRYYLNGVYMHVADGVEGGKALRCVATD 179

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLA  + ++      MP +IVPRK VGE+ ++L   +  + VS+SE+++     ++++
Sbjct: 180 GHRLARIDANLPMGAEDMPGVIVPRKTVGELRKLLDDDEMDIAVSVSETKVRFATPNITL 239

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + ++IDG FP+Y  VIP  N + L V+ +   +AVDRV+ +SS R +AVKL L  D+L +
Sbjct: 240 TSKVIDGTFPDYTRVIPAGNTRRLEVDASEFARAVDRVATVSSERSRAVKLQLDEDRLIL 299

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           +V+ PD G A E + V Y +  ++I FN KYLLEI     +++V  +  VF  +SS    
Sbjct: 300 SVNAPDSGAAEEELAVAYRDERLEIGFNAKYLLEI-----ANQVDRENAVFMFNSSGDPT 354

Query: 358 FIR-GKDKDSKNNKDNKVNAFYVLMPMRI 385
            +R G D+          +A YV+MPMR+
Sbjct: 355 LMREGSDE----------SAVYVVMPMRV 373


>gi|259417199|ref|ZP_05741118.1| DNA polymerase III, beta subunit [Silicibacter sp. TrichCH4B]
 gi|259346105|gb|EEW57919.1| DNA polymerase III, beta subunit [Silicibacter sp. TrichCH4B]
          Length = 373

 Score =  270 bits (689), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 149/389 (38%), Positives = 237/389 (60%), Gaps = 20/389 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKI++ER+ +L+ +  A  ++ER+NTIP+  +VL++A    +  +A+  +IE+    PA 
Sbjct: 1   MKISIERATLLKAVAQAQSVVERRNTIPILANVLIEAEGSDVMFRATDLDIEVVDKAPAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV+A  L++IVRKL DGA ++   +   G  + +  G SNF L + P  +FP 
Sbjct: 61  VERAGATTVAATTLHEIVRKLPDGALVTLNADAATG-RLTVEAGRSNFSLATLPREDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLK-LCAVATD 177
               EY  +F   ++VL+ L +++ FA++TEE RYYLNG++ H+   E   K L  VATD
Sbjct: 120 MATSEYHSNFTANAAVLRRLFDKSKFAISTEETRYYLNGVYMHVATGESGGKALRCVATD 179

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLA  + D+      MP +IVPRK VGE+ ++L   +  + VS+SE+++     ++++
Sbjct: 180 GHRLARIDADLPMGAEDMPGVIVPRKTVGELRKLLDDDEMDIAVSVSETKVRFATPNITL 239

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + ++IDG FP+Y  VIP  N + L V+ +   +AVDRV+ +SS R +AVKL L  D+L +
Sbjct: 240 TSKVIDGTFPDYTRVIPVGNTRRLEVDASEFAKAVDRVATVSSERSRAVKLQLDEDRLVL 299

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           +V+ PD G A E + V Y++  ++I FN KYLLEI     +++V  +  VF  +SS    
Sbjct: 300 SVNAPDSGAAEEELAVAYSDERLEIGFNAKYLLEI-----ANQVDRENAVFMFNSSGDPT 354

Query: 358 FIR-GKDKDSKNNKDNKVNAFYVLMPMRI 385
            +R G D+          +A YV+MPMR+
Sbjct: 355 LMREGSDE----------SAVYVVMPMRV 373


>gi|254474541|ref|ZP_05087927.1| DNA polymerase III, beta subunit [Ruegeria sp. R11]
 gi|214028784|gb|EEB69619.1| DNA polymerase III, beta subunit [Ruegeria sp. R11]
          Length = 373

 Score =  269 bits (688), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 145/388 (37%), Positives = 233/388 (60%), Gaps = 18/388 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKI++ER  +L+ +  A  ++ER+NTIP+  +VL++A     + +A+  +IE+    PA 
Sbjct: 1   MKISIERGTLLKAVAQAQSVVERRNTIPILANVLIEAEGDTAQFRATDLDIEVVDKAPAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV+A  L++IVRKL DGA ++   +   G  + +  G SNF L + P  +FP 
Sbjct: 61  VERAGATTVAATTLHEIVRKLPDGALVTLTADAASG-RLTVEAGRSNFSLATLPREDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHIN---EEDLKLCAVATD 177
               EY  +F   +++L+ L +++ FA++TEE RYYLNG++ H+    E    L  VATD
Sbjct: 120 MASSEYHSNFTANAAILRRLFDKSKFAISTEETRYYLNGVYMHVADAVEGGKALRCVATD 179

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLA  + ++      MP +IVPRK VGE+ ++L   +  + VS+SE+++     ++++
Sbjct: 180 GHRLARIDANLPMGAEDMPGVIVPRKTVGELRKLLDDDEMDIAVSVSETKVRFATPNITL 239

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + ++IDG FP+Y  VIP  N + L V+     +AVDRV+ +SS R +AVKL L  D+L +
Sbjct: 240 TSKVIDGTFPDYTRVIPAGNTRRLEVDAAEFARAVDRVATVSSERSRAVKLQLDDDRLIL 299

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           +V+ PD G A E + V Y++  ++I FN KYLLEI     +++V  +  VF  +SS    
Sbjct: 300 SVNAPDSGAAEEELAVAYSDERLEIGFNAKYLLEI-----ANQVDRENAVFLFNSSGDPT 354

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            +R         + N  +A YV+MPMR+
Sbjct: 355 LMR---------EGNDESAVYVVMPMRV 373


>gi|99079843|ref|YP_611997.1| DNA polymerase III subunit beta [Ruegeria sp. TM1040]
 gi|99036123|gb|ABF62735.1| DNA polymerase III, beta subunit [Ruegeria sp. TM1040]
          Length = 373

 Score =  269 bits (688), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 149/389 (38%), Positives = 237/389 (60%), Gaps = 20/389 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKI++ER+ +L+ +  A  ++ER+NTIP+  +VL++A    +  +A+  +IE+    PA 
Sbjct: 1   MKISIERATLLKAVAQAQSVVERRNTIPILANVLIEAEGSDVMFRATDLDIEVVDKAPAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV+A  L++IVRKL DGA ++   +   G  + +  G SNF L + P  +FP 
Sbjct: 61  VERAGATTVAATTLHEIVRKLPDGALVTLDADAASG-RLTVEAGRSNFSLATLPREDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLK-LCAVATD 177
               EY  +F   +++L+ L +++ FA++TEE RYYLNG++ H+   E   K L  VATD
Sbjct: 120 MATSEYHSNFTANAAMLRRLFDKSKFAISTEETRYYLNGVYMHVATGESGGKALRCVATD 179

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLA  + D+      MP +IVPRK VGE+ ++L   D  + VS+SE+++     ++++
Sbjct: 180 GHRLARIDADLPMGAEDMPGVIVPRKTVGELRKLLDEDDMDIAVSVSETKVRFATPNITL 239

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + ++IDG FP+Y  VIP  N + L V+ +   +AVDRV+ +SS R +AVKL L  D+L +
Sbjct: 240 TSKVIDGTFPDYTRVIPVGNTRRLEVDASEFAKAVDRVATVSSERSRAVKLQLDEDRLVL 299

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           +V+ PD G A E + V Y++  ++I FN KYLLEI     +++V  +  VF  +SS    
Sbjct: 300 SVNAPDSGAAEEELAVAYSDERLEIGFNAKYLLEI-----ANQVDRENAVFMFNSSGDPT 354

Query: 358 FIR-GKDKDSKNNKDNKVNAFYVLMPMRI 385
            +R G D+          +A YV+MPMR+
Sbjct: 355 LMREGSDE----------SAVYVVMPMRV 373


>gi|87199450|ref|YP_496707.1| DNA polymerase III subunit beta [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87135131|gb|ABD25873.1| DNA polymerase III, beta subunit [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 375

 Score =  269 bits (687), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 151/392 (38%), Positives = 231/392 (58%), Gaps = 24/392 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQAN-DGLLEIKASGPEIEITGAIPA 59
           MK T+ER+ +L  L H   ++ER+NTIP+  +VL++A  D  + + A+  +++I   + A
Sbjct: 1   MKATIERATLLRCLSHVQSVVERRNTIPILSNVLIEAAPDSTVRLMATDLDLQIIETMSA 60

Query: 60  -SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEF 118
            SV+  G+ITVSAHLL+DI RKL DG+Q+S    +     + +  G S F L + P  +F
Sbjct: 61  VSVEAPGAITVSAHLLFDIARKLPDGSQVSLETSDN---RMIVKAGRSRFQLPTLPRDDF 117

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK-LCAVATD 177
           P   E +   SFE+ +  L  L++RT FA++TEE RYYLNGIF H++++    L A ATD
Sbjct: 118 PVIVEGDLPTSFEIPARTLAELIDRTRFAISTEETRYYLNGIFLHVSDDPQPVLKAAATD 177

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSS-KDSSVKVSLSESRIHLNI---E 233
           GHRLA   +        MP +IVPRK VGE+ ++L    DS+V + LS S+I   +    
Sbjct: 178 GHRLARFTITRPDGAEGMPDVIVPRKCVGELRKLLEEVLDSAVLIDLSASKIRFTLGGEN 237

Query: 234 SLSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSD 293
            + ++ +LIDG FP+Y  VIP  NDK L+++  +  + VDRV+ +++ + +AVK++L +D
Sbjct: 238 GVVLTSKLIDGTFPDYSRVIPTGNDKLLKLDPRSFFEGVDRVATIATEKTRAVKMALEND 297

Query: 294 KLCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSS 353
           ++ ++V +PD G A E +   Y+    +I FN  YL +I+  I       D V   L  +
Sbjct: 298 RVTLSVTSPDNGTAAEELPADYSSTGFEIGFNANYLKDILSQIDG-----DTVELHLADA 352

Query: 354 NSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            +   IR         KD+K  A YVLMPMR+
Sbjct: 353 GAPTLIR---------KDDKSAALYVLMPMRV 375


>gi|126738626|ref|ZP_01754331.1| DNA polymerase III subunit beta [Roseobacter sp. SK209-2-6]
 gi|126720425|gb|EBA17131.1| DNA polymerase III subunit beta [Roseobacter sp. SK209-2-6]
          Length = 373

 Score =  269 bits (687), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 145/388 (37%), Positives = 233/388 (60%), Gaps = 18/388 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKI++ER  +L+ +  A  ++ER+NTIP+  +VL++A     + +A+  +IE+    PA 
Sbjct: 1   MKISIERGTLLKAVAQAQSVVERRNTIPILANVLIEAEGDTAQFRATDLDIEVVDKAPAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV+A  L++IVRKL DGA ++   +   G  +++  G SNF L + P  +FP 
Sbjct: 61  VERAGATTVAATTLHEIVRKLPDGALVTLTSDAATG-RLSVDAGRSNFSLATLPREDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHIN---EEDLKLCAVATD 177
               EY  +F   +++L+ L +++ FA++TEE RYYLNG++ H++   E    L  VATD
Sbjct: 120 MATSEYHSNFTANAAMLRRLFDKSKFAISTEETRYYLNGVYMHVSDAAEGGKALRCVATD 179

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLA  +  +      MP +IVPRK VGE+ ++L   +  + VS+SE+++     ++++
Sbjct: 180 GHRLARIDAPLPLGAEDMPGVIVPRKTVGELRKLLDDDEMDIAVSVSETKVRFATPNITL 239

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + ++IDG FP+Y  VIP  N + L V+ +   +AVDRV+ +SS R +AVKL L  D+L +
Sbjct: 240 TSKVIDGTFPDYTRVIPVGNTRRLEVDASEFAKAVDRVATVSSERSRAVKLQLEEDRLVL 299

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           +V+ PD G A E + V Y +  ++I FN KYLLEI     + +V  +  VF  +SS    
Sbjct: 300 SVNAPDSGAAEEELAVAYGDERLEIGFNAKYLLEI-----ASQVDRENAVFLFNSSGDPT 354

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            +R         + N  +A YV+MPMR+
Sbjct: 355 LMR---------EGNDESAVYVVMPMRV 373


>gi|86139416|ref|ZP_01057985.1| DNA polymerase III subunit beta [Roseobacter sp. MED193]
 gi|85823919|gb|EAQ44125.1| DNA polymerase III subunit beta [Roseobacter sp. MED193]
          Length = 373

 Score =  268 bits (685), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 146/389 (37%), Positives = 234/389 (60%), Gaps = 20/389 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MKI++ER  +L+ +  A  ++ER+NTIP+  +VL++A   + + +A+  +IE+    PA 
Sbjct: 1   MKISIERGTLLKAVAQAQSVVERRNTIPILANVLIEAEGDVAQFRATDLDIEVVDKAPAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+ TV+A  L++IVRKL DGA ++   +   G  + +  G SNF L + P  +FP 
Sbjct: 61  VERAGATTVAATTLHEIVRKLPDGALVTLTADAATG-RLTVEAGRSNFSLATLPREDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHIN---EEDLKLCAVATD 177
               EY  +F   +++L+ L +++ FA++TEE RYYLNG++ H++   E    L  VATD
Sbjct: 120 MASSEYHSNFTANAAMLRRLFDKSKFAISTEETRYYLNGVYMHVSDAAEGGKVLRCVATD 179

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLA  +  +      MP +IVPRK VGE+ ++L   +  + VS+SE+++     ++++
Sbjct: 180 GHRLARIDASLPVGAEDMPGVIVPRKTVGEMRKLLDDDEMDIAVSVSETKVRFATPNITL 239

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + ++IDG FP+Y  VIP  N + L V+     +AVDRV+ +SS R +AVKL L  D+L +
Sbjct: 240 TSKVIDGTFPDYTRVIPAGNTRRLEVDADEFARAVDRVATVSSERSRAVKLQLEEDRLIL 299

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           +V+ PD G A E + V Y +  ++I FN KYLLEI     +++V  +  VF  +SS    
Sbjct: 300 SVNAPDSGAAEEELAVAYADERLEIGFNAKYLLEI-----ANQVDRENAVFMFNSSGDPT 354

Query: 358 FIR-GKDKDSKNNKDNKVNAFYVLMPMRI 385
            +R G D+          +A YV+MPMR+
Sbjct: 355 LMREGSDE----------SAVYVVMPMRV 373


>gi|296532158|ref|ZP_06894919.1| DNA-directed DNA polymerase III beta subunit [Roseomonas cervicalis
           ATCC 49957]
 gi|296267517|gb|EFH13381.1| DNA-directed DNA polymerase III beta subunit [Roseomonas cervicalis
           ATCC 49957]
          Length = 375

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 154/401 (38%), Positives = 226/401 (56%), Gaps = 42/401 (10%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPA- 59
           MK +V+R+ +L+ L H   ++ER+NTIP+  +V+L A DG L + A+  EI I   +P  
Sbjct: 1   MKFSVDRAVLLKALAHVQSVVERRNTIPILANVMLAAQDGTLTLTATDMEIAIVEDVPGV 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQS------- 112
           +V   G  T  A  LY+IVRKL DGA++          E++ + GD+   L++       
Sbjct: 61  TVSRAGRTTAPAATLYEIVRKLPDGAKV----------ELDHAGGDAPLALRAGRFATSL 110

Query: 113 --FPESEFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK 170
              P  +FPS  E +  + F++  ++L+ LV+RT FA++TEE RYYLNGI+ H  E D +
Sbjct: 111 MVLPVEDFPSMTEGKLPHGFQIPPALLRELVDRTKFAISTEETRYYLNGIYLHATEVDGQ 170

Query: 171 --LCAVATDGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRI 228
             L AVATDGHRLA  E  +      MP +IVPRK V EI ++      +++V LS+++I
Sbjct: 171 KVLRAVATDGHRLARVEEPLPEGAEGMPGVIVPRKTVNEIRKLADETGDAIEVKLSDTKI 230

Query: 229 HLNIESLSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKL 288
                S+ ++ +LIDG FP Y+ VIP  NDK + V+      AV RV+ +SS R + VKL
Sbjct: 231 SFAFGSVRLTSKLIDGTFPEYERVIPRGNDKIMTVDKKAFADAVSRVAAISSERSRPVKL 290

Query: 289 SLSSDKLCMTVDNPDMGKAIESMN---VYYNECPMDICFNYKYLLEIIDNISSDEVVDDE 345
           SL  D L +T  +PD G+A E ++   V Y   P++I F  +YL +I D I+      ++
Sbjct: 291 SLKQDSLTLTASSPDQGQAEEELDNGAVSYGSGPIEIGFQARYLADITDQIA------EK 344

Query: 346 VVFRL-DSSNSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           V FR  D S  +V +             K  A YVLMPMR+
Sbjct: 345 VEFRFADGSAPTVVVDAA----------KPEALYVLMPMRV 375


>gi|85708877|ref|ZP_01039943.1| DNA polymerase III beta subunit [Erythrobacter sp. NAP1]
 gi|85690411|gb|EAQ30414.1| DNA polymerase III beta subunit [Erythrobacter sp. NAP1]
          Length = 375

 Score =  265 bits (677), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 151/393 (38%), Positives = 228/393 (58%), Gaps = 26/393 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDG-LLEIKASGPEIEITGAIPA 59
           MK T+ER+ +L  L H   ++ER+NTIP+  +VL+ A+DG  +++ A+  ++++   + A
Sbjct: 1   MKATIERATLLRCLSHVQSVVERRNTIPILSNVLIDASDGGSVKVMATDLDLQVVETMNA 60

Query: 60  S-VDVCGSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESE 117
           S V+  G+ITVSAHLL+DI RKL DGAQ+S    EN +     +  G + F L + P  +
Sbjct: 61  SSVESPGAITVSAHLLFDIARKLPDGAQVSLETAENRM----EVKAGRARFKLPTLPRDD 116

Query: 118 FPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK-LCAVAT 176
           FP   E +   SFE+ +  L  +++ T FA++TEE RYYLNGIF H+ +ED   L A AT
Sbjct: 117 FPVIVEGDLPTSFEIPARTLAQMIDATRFAISTEETRYYLNGIFLHVTDEDEPVLKAAAT 176

Query: 177 DGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSK-DSSVKVSLSESRIHLNIES- 234
           DGHRLA   +        MP +IVPRKAV E+ ++L    D +V+V LS S+I   +   
Sbjct: 177 DGHRLARFTLARPDGAEGMPDVIVPRKAVAELRKLLEEALDGAVQVDLSASKIRFTLGGE 236

Query: 235 --LSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSS 292
             + ++ +LIDG FP+Y  VIP  NDK L+V+     + VDRV+ +++ + +AVK+ L +
Sbjct: 237 GGVVLTSKLIDGTFPDYSRVIPTGNDKLLKVDPKLFFEGVDRVATIATEKTRAVKMGLDA 296

Query: 293 DKLCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDS 352
           DK+ ++V +PD G A E +   Y     +I FN  YL +I+    +     +E+   L  
Sbjct: 297 DKVTLSVTSPDNGNAAEELMADYKSDGFEIGFNANYLKDILGQFDA-----EEIELHLAD 351

Query: 353 SNSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +   IR  D            A YVLMPMR+
Sbjct: 352 AGAPTLIRESDTSP---------ALYVLMPMRV 375


>gi|329113488|ref|ZP_08242269.1| DNA polymerase III subunit beta [Acetobacter pomorum DM001]
 gi|326697313|gb|EGE48973.1| DNA polymerase III subunit beta [Acetobacter pomorum DM001]
          Length = 374

 Score =  265 bits (676), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 148/390 (37%), Positives = 223/390 (57%), Gaps = 21/390 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK + ER+ +L+ L H   + E++NTIP+  +VL+QA +G L +KA+  EIE+   +PA+
Sbjct: 1   MKFSAERATLLKALAHIQSVAEKRNTIPILANVLIQAANGQLSLKATDMEIEVVEGVPAN 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           +   G+ T  A +LY+IVRKL DG  +   + +  G  + +  G     L      +FPS
Sbjct: 61  ITREGATTAPASVLYEIVRKLPDGVDVELDQADSEGP-LLLRAGRYATRLNVLSVDDFPS 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
               ++ Y F+L ++ L +L++RT FA++TEE RYYLNGIF H  E D   KL AVATDG
Sbjct: 120 MGAGDFPYRFKLPATTLHSLIDRTRFAISTEETRYYLNGIFLHGTEVDGEPKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  E D+ +  A MP +IVPRK V E+ +++      V+++LSE+RI      ++++
Sbjct: 180 HRLARVEADLPSGAAGMPGVIVPRKTVAEVRKLIDEAPEEVEIALSETRIQFTAGPVTLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP Y+ VIP +N + LRV   +   AV RV+ +S  R + VKL+L    L ++
Sbjct: 240 SKLIDGTFPEYERVIPRNNTRILRVGKKDFADAVARVAAISQERSRPVKLTLEPGLLTLS 299

Query: 299 VDNPDMGKAIESMN---VYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNS 355
             + + G A E ++   + Y+   ++I F  +YL +I D       V+ EV F    S S
Sbjct: 300 ASSTEQGMAKEELDDNRISYDAEGLEIGFQARYLNDITDQ------VEKEVEFAFADSAS 353

Query: 356 SVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
              +R  D  S         A YVLMPMR+
Sbjct: 354 PTIVRDVDSPS---------ALYVLMPMRV 374


>gi|329847539|ref|ZP_08262567.1| DNA polymerase III, beta subunit [Asticcacaulis biprosthecum C19]
 gi|328842602|gb|EGF92171.1| DNA polymerase III, beta subunit [Asticcacaulis biprosthecum C19]
          Length = 373

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 143/387 (36%), Positives = 229/387 (59%), Gaps = 16/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ T+ER  +L+ LGH   ++ER+NTIP+  +VLL A  G +   A+  ++EI     A+
Sbjct: 1   MQFTIERGALLKALGHVQNVVERRNTIPILSNVLLSAERGQVSFSATDLDMEIVDTAEAT 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V V G IT  AH LY+IVRKL DGA +           + +S G S F L   P  +FP 
Sbjct: 61  VSVPGQITAPAHTLYEIVRKLPDGADVELKFSAGDDPRLAVSAGRSRFALPVLPAGDFPI 120

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK--LCAVATDG 178
              +    SF +    LK L+++T FA++TEE RYYLNG++ H   ED    L AVATDG
Sbjct: 121 MSSDHEGVSFSILRDDLKRLIDKTRFAVSTEETRYYLNGMYLHTLSEDGSNYLRAVATDG 180

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA+AE+      A  P +I+PRK + +  R+L      V++++S ++I   + + S++
Sbjct: 181 HRLALAEMPAPEGSAGGPGVIIPRKTIDQARRLLDDGTGYVELTISPAKIRFQLGNASLT 240

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP +NDK + ++   L +AVDRVS +S+ + ++VK+++   +L ++
Sbjct: 241 SKIIDGSFPDYGRVIPKNNDKVMMIDTGILAKAVDRVSTISAEKSRSVKMAIEPGRLTLS 300

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V N + G+A+E   + Y+   +DI FN +Y+L+++  I  ++V   E+ F  D+S+ ++ 
Sbjct: 301 VRNIEAGQAVEEAEIDYDNDSIDIGFNARYILDVMGQIGGEQV---ELRF-ADASSPTLV 356

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +        +  DN V   YVLMP+R+
Sbjct: 357 L--------DPADNGVQ--YVLMPLRV 373


>gi|258542325|ref|YP_003187758.1| DNA polymerase III subunit beta [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633403|dbj|BAH99378.1| DNA polymerase III beta subunit [Acetobacter pasteurianus IFO
           3283-01]
 gi|256636462|dbj|BAI02431.1| DNA polymerase III beta subunit [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639515|dbj|BAI05477.1| DNA polymerase III beta subunit [Acetobacter pasteurianus IFO
           3283-07]
 gi|256642571|dbj|BAI08526.1| DNA polymerase III beta subunit [Acetobacter pasteurianus IFO
           3283-22]
 gi|256645626|dbj|BAI11574.1| DNA polymerase III beta subunit [Acetobacter pasteurianus IFO
           3283-26]
 gi|256648679|dbj|BAI14620.1| DNA polymerase III beta subunit [Acetobacter pasteurianus IFO
           3283-32]
 gi|256651732|dbj|BAI17666.1| DNA polymerase III beta subunit [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654723|dbj|BAI20650.1| DNA polymerase III beta subunit [Acetobacter pasteurianus IFO
           3283-12]
          Length = 374

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 148/390 (37%), Positives = 222/390 (56%), Gaps = 21/390 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK + ER+ +L+ L H   + E++NTIP+  +VL+QA +G L +KA+  EIE+   +PA 
Sbjct: 1   MKFSAERATLLKALAHIQSVAEKRNTIPILANVLIQAANGQLSLKATDMEIEVVEEVPAK 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           +   G+ T  A +LY+IVRKL DG  +   + +  G  + +  G     L      +FPS
Sbjct: 61  ITREGATTAPAAVLYEIVRKLPDGVDVELDQADSEGP-LLLRAGRYATRLNVLSVDDFPS 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
               ++ + F+L ++ L +L++RT FA++TEE RYYLNGIF H  E D   KL AVATDG
Sbjct: 120 MGAGDFPHRFKLPATTLHSLIDRTRFAISTEETRYYLNGIFLHGTEVDGEAKLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  E D+ A  A MP +IVPRK V E+ +++      V+++LSE+RI      ++++
Sbjct: 180 HRLARVEADLPAGAAGMPGVIVPRKTVAEVRKLIDEAPEEVEIALSETRIQFTAGPVTLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP Y+ VIP +N + LRV   +   AV RV+ +S  R + VKL+L    L ++
Sbjct: 240 SKLIDGTFPEYERVIPRNNTRILRVGKKDFADAVARVAAISQERSRPVKLTLEPGLLTLS 299

Query: 299 VDNPDMGKAIESMN---VYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNS 355
             + + G A E ++   + Y+   ++I F  +YL +I D       V+ EV F    S S
Sbjct: 300 ASSAEQGVAKEELDDNRISYDAEGLEIGFQARYLNDITDQ------VEKEVEFAFADSAS 353

Query: 356 SVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
              +R  D  S         A YVLMPMR+
Sbjct: 354 PTIVRDVDSPS---------ALYVLMPMRV 374


>gi|114798873|ref|YP_759292.1| DNA polymerase III subunit beta [Hyphomonas neptunium ATCC 15444]
 gi|114739047|gb|ABI77172.1| DNA polymerase III, beta subunit [Hyphomonas neptunium ATCC 15444]
          Length = 373

 Score =  263 bits (671), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 150/388 (38%), Positives = 228/388 (58%), Gaps = 18/388 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+T+ER D+L+ L H   I+ER+ TIP+  +VLL+A  G L++ A+  +IE   +  A+
Sbjct: 1   MKLTIERGDLLDALSHVQNIVERRTTIPILSNVLLEATQGALKLTATDLDIEAVDSALAN 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V   GS+T  A  L+D+VRKL  GA++   + N     + I+ G S F L + P ++F +
Sbjct: 61  VSRPGSVTAPAGTLFDVVRKLPSGAEVEL-ELNPESQRLTIAAGRSLFELPTLPAADFQT 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED---LKLCAVATD 177
              +E   SF++A+     L+++T FA++TEE RYYLNGI+ H  + D     L  VATD
Sbjct: 120 MTPDEGAVSFKIAAKDFARLIDKTRFAISTEETRYYLNGIYLHAAKADDGSAVLRTVATD 179

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLA+AE+       K+  +IVPRK VGE  R+L   D  V++ +S+++I L      +
Sbjct: 180 GHRLALAELKAPKGAEKLTGVIVPRKTVGEARRLLDGLDEDVEIEVSDTKIILRAGRAVL 239

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +LIDG FP+Y  VIP  NDK++ V+      AVDRVS +S+ R ++VKLS+S+ +L +
Sbjct: 240 TSKLIDGSFPDYARVIPKGNDKKMTVDNKAFEAAVDRVSTVSAERSRSVKLSVSNGRLTL 299

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
            V++ + G   E +   Y   PM+I FN KYLL+I   I S EV   E +F   +S + V
Sbjct: 300 AVNHAETGAGNEEIEAEYESEPMEIGFNAKYLLDIAGQIESSEV---EFMFNDPASPALV 356

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
                D           +A +V+MP+R+
Sbjct: 357 LDPSDD-----------SARFVVMPLRV 373


>gi|326387150|ref|ZP_08208760.1| DNA polymerase III subunit beta [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326208331|gb|EGD59138.1| DNA polymerase III subunit beta [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 356

 Score =  263 bits (671), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 147/372 (39%), Positives = 225/372 (60%), Gaps = 25/372 (6%)

Query: 20  IIERKNTIPVSCHVLLQAN-DGLLEIKASGPEIEITGAIPA-SVDVCGSITVSAHLLYDI 77
           ++ER+NTIP+  +VL+ A   G +++ A+  +++I  ++PA SV+V G+ITVSAHLL+DI
Sbjct: 4   VVERRNTIPILSNVLIDAAATGSVKLMATDLDLQIIESMPAVSVEVPGAITVSAHLLFDI 63

Query: 78  VRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPSTKEEEYVYSFELASSVL 137
            RKL DG+Q+S    +     + +  G S F L + P  +FP   E +   SFE+ +  L
Sbjct: 64  ARKLPDGSQVSLETADN---RMIVKAGRSRFQLPTLPRDDFPVIVEGDLPTSFEIPARTL 120

Query: 138 KNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAVAEVDIVAQIAKMPS 197
             L++RT FA++TEE RYYLNGIFFH+++E LK  A ATDGHRLA   +        MP 
Sbjct: 121 AELIDRTRFAISTEETRYYLNGIFFHVSDEVLK--AAATDGHRLARYTLPRPEGAEGMPD 178

Query: 198 IIVPRKAVGEILRILSS-KDSSVKVSLSESRIHLNIES---LSMSVRLIDGEFPNYQNVI 253
           +I+PRK VGE+ ++L    D++V V LS S++   +     + ++ +LIDG FP+Y  VI
Sbjct: 179 VIIPRKCVGELRKLLEDVLDTNVLVDLSASKVRFTLGGEFGVVLTSKLIDGTFPDYSRVI 238

Query: 254 PCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPDMGKAIESMNV 313
           P  NDK LR++  +  + VDRV+ +++ + +AVK++L +D++ ++V +PD G A E +  
Sbjct: 239 PTGNDKLLRLDPRSFFEGVDRVATIATEKTRAVKMALDTDRVTLSVTSPDNGTAAEELPA 298

Query: 314 YYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIRGKDKDSKNNKDNK 373
            Y     +I FN  YL +I+  I       D V   L  +++   IR         KD+K
Sbjct: 299 DYQASGFEIGFNANYLKDILSQIDG-----DLVELHLADASAPTLIR---------KDDK 344

Query: 374 VNAFYVLMPMRI 385
             A YVLMPMR+
Sbjct: 345 SPALYVLMPMRV 356


>gi|296446087|ref|ZP_06888036.1| DNA polymerase III, beta subunit [Methylosinus trichosporium OB3b]
 gi|296256446|gb|EFH03524.1| DNA polymerase III, beta subunit [Methylosinus trichosporium OB3b]
          Length = 371

 Score =  262 bits (670), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 145/388 (37%), Positives = 226/388 (58%), Gaps = 20/388 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+T++R+ +L+ L    RI E++ TIP+  H LL+ + G L I+A+  +IE    + A 
Sbjct: 1   MKLTIDRAPLLKALETTRRIAEQRTTIPILSHALLETDHGRLCIRATDLDIETRILLDAE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           +   G++ VSA +L+D+ RKL + AQI+   E +   ++ +  G S F L + P   FP 
Sbjct: 61  IAETGALAVSAAVLHDLTRKLPEKAQITL--EGQEAGQLQMRSGRSRFKLSTLPADTFPD 118

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK--LCAVATDG 178
           T E  +   F L ++ L  ++ +T FA++TEE RYYLNG+FFH  E+D +  L  VATDG
Sbjct: 119 TTEHGFSADFALPAATLARMLGKTAFAISTEETRYYLNGVFFHHMEDDGRALLRMVATDG 178

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRL+  E +  A  A MP +IVPRKA  EI R+L  +++  ++++S +++  ++  +++S
Sbjct: 179 HRLSRIETEAPAGAAAMPGVIVPRKACAEIERLLKGQEAEARLAVSANKLRFSLGDVTLS 238

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y  VIP  NDK   ++ T +  A DRVS + S R +AVKLS  +  L ++
Sbjct: 239 TKLIDGTFPDYARVIPQGNDKRATLDRTAMAAAADRVSTIHSERGRAVKLSFDASALTLS 298

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRL-DSSNSSV 357
           V NPDMG+A + M   Y+  P++I FN +YL E +  +       D  V RL D    ++
Sbjct: 299 VTNPDMGEARDEMEADYDSSPIEIGFNSRYLAEALQVLEG-----DSAVIRLADPGAPTL 353

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           F              + +   VLMPMR+
Sbjct: 354 F----------QSATQPDLLIVLMPMRV 371


>gi|114326983|ref|YP_744140.1| DNA polymerase III subunit beta [Granulibacter bethesdensis
           CGDNIH1]
 gi|114315157|gb|ABI61217.1| DNA polymerase III, beta chain [Granulibacter bethesdensis CGDNIH1]
          Length = 387

 Score =  261 bits (666), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 149/400 (37%), Positives = 222/400 (55%), Gaps = 40/400 (10%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK   ER+ +L+ L H   ++E++NTIP+  +VLL+  DG L   A+  EI I   +PA 
Sbjct: 13  MKFKAERAVLLKALAHVQSVVEKRNTIPILANVLLEVKDGSLRFTATDMEIAIVEDVPAE 72

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQS-------- 112
               G++T  A  LY+IVRKL DGA +          E++   GD    L+S        
Sbjct: 73  GLRDGAVTAPAGTLYEIVRKLPDGADV----------ELDHQAGDQQLMLKSGRYATKLV 122

Query: 113 -FPESEFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINE---ED 168
             P  +FPS       + F LA +VL+ L++RT FA++TEE RYYLNGI+FH  +   + 
Sbjct: 123 VLPTDDFPSMTTGALPHQFRLAGNVLRGLIDRTRFAISTEETRYYLNGIYFHAAQGGPDG 182

Query: 169 LKLCAVATDGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRI 228
             L AVATDGHRLA  E  +      MP +IVPRK V E+ ++L     +V V+LS++RI
Sbjct: 183 AALRAVATDGHRLARVEEPLPEGALGMPGVIVPRKTVAELRKLLDEVTDTVDVALSDTRI 242

Query: 229 HLNIESLSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKL 288
                 ++++ +LIDG FP Y+ VIP  NDK LRV   +   AV RV+ +SS R + VK+
Sbjct: 243 QFVAGPVTLTSKLIDGTFPEYERVIPKDNDKVLRVGKNDFSAAVARVAAISSERSRPVKM 302

Query: 289 SLSSDKLCMTVDNPDMGKAIESMN---VYYNECPMDICFNYKYLLEIIDNISSDEVVDDE 345
           +L  + L ++  +PD G A E ++   + Y    ++I F  +YL +I D I+      +E
Sbjct: 303 ALDRNLLVLSASSPDQGTATEELDGDRIQYEAGALEIGFQARYLNDITDQIA------EE 356

Query: 346 VVFRLDSSNSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           V FR    ++   +    +D+ ++     +A YVLMPMR+
Sbjct: 357 VEFRFADGSAPTVV----QDAADS-----SALYVLMPMRV 387


>gi|302381118|ref|YP_003816941.1| DNA polymerase III subunit beta [Brevundimonas subvibrioides ATCC
           15264]
 gi|302191746|gb|ADK99317.1| DNA polymerase III, beta subunit [Brevundimonas subvibrioides ATCC
           15264]
          Length = 372

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 143/387 (36%), Positives = 220/387 (56%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T+ERS +L+ LGH   ++ER+NTIP+  +VLL A    L   A+  ++EI     A+
Sbjct: 1   MQLTIERSALLKALGHVQSVVERRNTIPILSNVLLSAGRDRLSFAATDLDMEIVDEADAT 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V V G IT  AH LY+IVRKL DGA+++    N     + +  G S F L   P  +FP 
Sbjct: 61  VQVEGQITAPAHTLYEIVRKLPDGAEVAL-TYNGDDPRLTVQAGRSKFNLPVLPAGDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFH-INEEDLKLC-AVATDG 178
              ++    F L    L  L+++T FA++TEE RYYLNG++ H + E  + L  AVATDG
Sbjct: 120 MSTDQSGARFTLMKDDLARLIDKTRFAVSTEETRYYLNGLYLHTVAEGGIPLLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA+AE       A  P +IVPRK + ++ R+L      V++S+S  +I       S++
Sbjct: 180 HRLALAETPAPEGAAGGPGVIVPRKTIDQVRRLLDDGTGPVEISVSPQKIRFEFGQASLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  NDK+  ++      AVDRV+ +S+ + ++VKL+   D++ +T
Sbjct: 240 SKVIDGAFPDYMRVIPKGNDKQADIDNAVFASAVDRVATISAEKSRSVKLAFELDRVTLT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V N + G+ +E + + Y+E P +I FN +YLL++   I+ +       +F   +S + V 
Sbjct: 300 VRNMEAGQGVEEVEIGYSEAPFEIGFNARYLLDVAGQITGENAT---FLFADPASPTLVL 356

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             G         D  V   YVLMP+R+
Sbjct: 357 DPG---------DPGVQ--YVLMPLRV 372


>gi|330994265|ref|ZP_08318193.1| DNA polymerase III subunit beta [Gluconacetobacter sp. SXCC-1]
 gi|329758732|gb|EGG75248.1| DNA polymerase III subunit beta [Gluconacetobacter sp. SXCC-1]
          Length = 380

 Score =  259 bits (662), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 150/399 (37%), Positives = 223/399 (55%), Gaps = 39/399 (9%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+  +R  +L+ L H   + E++NTIP+  +VL+   DG + + A+  EI +   + A 
Sbjct: 7   MKLKADRVTLLKALAHIQSVAEKRNTIPILANVLINVVDGAMTLTATDMEIAVVEGVAAE 66

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQS--FPES-- 116
               G++T  A +LY+IVRKL DGAQ+          E++ + GD+   L++  F  S  
Sbjct: 67  TQRDGAVTAPAAVLYEIVRKLPDGAQV----------ELDHAGGDAPLGLRAGRFATSLN 116

Query: 117 -----EFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK- 170
                +FPS       + F + + VL+ L++RT FA++TEE RYYLNGIF H+ E +   
Sbjct: 117 VLDVDDFPSMMAGALPHEFSMPAQVLRGLIDRTRFAISTEETRYYLNGIFLHVAEGETGP 176

Query: 171 -LCAVATDGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIH 229
            L AVATDGHRLA  E ++ A  A MP +IVPRK V E+ ++L      V V+LS++RI 
Sbjct: 177 VLRAVATDGHRLARVETELPAGSAGMPGVIVPRKTVAELRKLLDEGPEQVAVALSDTRIQ 236

Query: 230 LNIESLSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLS 289
            +I +++++ +LIDG FP Y+ VIP  NDK LRV       AV RV+ +S  R + VKLS
Sbjct: 237 FSIGNITLTSKLIDGTFPEYERVIPHGNDKILRVGKKIFSDAVSRVAAISQERSRPVKLS 296

Query: 290 LSSDKLCMTVDNPDMGKAIESMN---VYYNECPMDICFNYKYLLEIIDNISSDEVVDDEV 346
           +  + L ++  + D G A E ++   V Y   P++I F  +YL +I D       V+ EV
Sbjct: 297 MGHNLLTLSAASQDQGTATEELDENHVSYAASPIEIGFQARYLNDITDQ------VEREV 350

Query: 347 VFRLDSSNSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            F    S++   +R  D  S         A YVLMPMR+
Sbjct: 351 EFAFSDSSAPTIVRDVDSPS---------ALYVLMPMRV 380


>gi|297717814|gb|ADI50050.1| DNA polymerase III beta subunit [Candidatus Odyssella
           thessalonicensis L13]
          Length = 375

 Score =  259 bits (662), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 137/390 (35%), Positives = 231/390 (59%), Gaps = 20/390 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  VER D L+ L H   ++E++ T+P+  HVL+QA D  L +  +  ++ +  +IPA 
Sbjct: 1   MKFAVERGDFLKALAHGGSVVEKRTTVPILSHVLIQAEDSQLHLTTTDMDLALVESIPAV 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  GSITVSAH+L +IVRKL DG +I     N+   ++ +  G S F + + P  +FP 
Sbjct: 61  VEAPGSITVSAHMLLEIVRKLPDGVKIE-ATLNQANDQLTLKAGKSRFNIATLPAEQFPK 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK--LCAVATDG 178
             + +  +SF+L +  L+ L++R+ FAM+TEE RY+LNGI+FH +E + +    +VATD 
Sbjct: 120 LTQNDLPFSFKLTAEKLRYLIDRSRFAMSTEETRYFLNGIYFHAHEINGQKVFRSVATDA 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSK--DSSVKVSLSESRIHLNIESLS 236
           HRLA  EV +      +P IIV RK + EI ++++ +  ++ + +SLS  R+   +   +
Sbjct: 180 HRLACIEVPVPEGAESIPGIIVGRKTITEIRKLINDENPEAEITISLSPQRVEFKLPQAT 239

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
           +S RL+DG +P+Y+  IP  NDK + V+  +  +AVDRV+ +++ ++  +K+S++ +KL 
Sbjct: 240 LSSRLVDGTYPDYEQAIPKGNDKPVIVDAKDFAKAVDRVATVTTDKLPVIKISVAKNKLT 299

Query: 297 MTVDNPDMGKAIESMNVYYN-ECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNS 355
           +   + ++G A E M V +  +  ++I FN  YL++I   I      D+     L   ++
Sbjct: 300 LVAASSELGDATEEMEVDFPFDHSIEIGFNANYLVDITSQIG-----DEAAEILLSDGSA 354

Query: 356 SVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
              I+G      N+K+    A +VLMPMR+
Sbjct: 355 PAIIKG-----INDKE----ALFVLMPMRV 375


>gi|254417831|ref|ZP_05031555.1| DNA polymerase III, beta subunit [Brevundimonas sp. BAL3]
 gi|196184008|gb|EDX78984.1| DNA polymerase III, beta subunit [Brevundimonas sp. BAL3]
          Length = 372

 Score =  257 bits (656), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 141/387 (36%), Positives = 223/387 (57%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T+ERS +L+ LGH   ++ER+NTIP+  +VLL A    L   A+  ++E+     A+
Sbjct: 1   MQLTIERSALLKALGHVQSVVERRNTIPILSNVLLSAGRDRLAFAATDLDMEMVDEAEAT 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+V G IT  AH LY+IVRKL +GA++S     +    + +S G S F L   P  +FP 
Sbjct: 61  VNVEGQITAPAHTLYEIVRKLPEGAEVSLLYSGD-DPRLVVSAGRSRFNLPVLPAGDFPI 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFH-INEEDLKLC-AVATDG 178
              +    S+ +    L  L+++T FA++TEE RYYLNG++ H + E  + L  AVATDG
Sbjct: 120 MSTDSAGASYVMPKEDLARLIDKTRFAVSTEETRYYLNGLYLHTVAEAGVALLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA+AE       A  P +IVPRK V ++ R+L      V++++S  +I   I   S++
Sbjct: 180 HRLALAETPAPEGAAGGPGVIVPRKTVDQVRRLLDDAAGPVEITVSAQKIRFQIGEASLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  NDK+  ++     +AVDRV+ +S+ + ++VKL+  +D++ +T
Sbjct: 240 SKVIDGAFPDYLRVIPKGNDKQADIDNALFAKAVDRVATISAEKSRSVKLAFDNDRVKLT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V N + G+A E + + Y++ P +I FN +YLL++   I+      +   FR     S   
Sbjct: 300 VRNMEAGQAEEEVEIGYSDEPFEIGFNARYLLDVAGQITG-----ENAAFRFADPASPTL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +        +  D  V   YVLMP+R+
Sbjct: 355 V-------LDPGDPGVQ--YVLMPLRV 372


>gi|315497053|ref|YP_004085857.1| DNA polymerase iii, beta subunit [Asticcacaulis excentricus CB 48]
 gi|315415065|gb|ADU11706.1| DNA polymerase III, beta subunit [Asticcacaulis excentricus CB 48]
          Length = 373

 Score =  255 bits (652), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 137/387 (35%), Positives = 223/387 (57%), Gaps = 16/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++ +ER  +L+ LGH   ++ER+NTIP+  +VLL A    +   A+  ++EI  +  A 
Sbjct: 1   MQLIIERGALLKALGHVQNVVERRNTIPILSNVLLSAEGSQVSFSATDLDMEIVDSAEAI 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V V G IT  AH LY+IVRKL DGA +    +      + +  G S F L   P  +FP 
Sbjct: 61  VAVPGQITAPAHTLYEIVRKLPDGADVELRYQAGDDPRLTVQAGRSRFALPVLPAGDFPV 120

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLK--LCAVATDG 178
              +    ++ L    LK L+++T FA++TEE RYYLNG+F H   ED    L AVATDG
Sbjct: 121 MSGDHDGTTYALLKEDLKRLIDKTRFAVSTEETRYYLNGLFLHTLTEDGSGYLRAVATDG 180

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA+AE+           +I+PRK + +  R+L      V++++S ++I  N  + +++
Sbjct: 181 HRLALAEMPAPDGSMGSAGVIIPRKTIDQARRLLDDGTGYVELTVSPAKIRFNFGTAALT 240

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP +NDK +R++   L +AVDRVS +S+ + ++VK+++   +L +T
Sbjct: 241 SKIIDGSFPDYGRVIPKNNDKLMRIDTGILSRAVDRVSTISAEKSRSVKMAIEPGRLTLT 300

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V N + G+A+E   + Y+   ++I FN +Y+L+++  I+      ++V  RL+ + S   
Sbjct: 301 VRNIEAGQAVEEAEIDYDSDSLEIGFNARYILDVMGQIAG-----EQVELRLNDAASPTL 355

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +        +  D  V   YVLMP+R+
Sbjct: 356 V-------LDTADQGVQ--YVLMPLRV 373


>gi|162147556|ref|YP_001602017.1| DNA polymerase III subunit beta [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209542190|ref|YP_002274419.1| DNA polymerase III subunit beta [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161786133|emb|CAP55715.1| DNA polymerase III subunit beta [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209529867|gb|ACI49804.1| DNA polymerase III, beta subunit [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 374

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 145/399 (36%), Positives = 218/399 (54%), Gaps = 39/399 (9%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+  +R+ +L+ L H   + E++NTIP+  +VL+   DG L + A+  EI +   I A 
Sbjct: 1   MKLKADRATLLKALAHIQSVAEKRNTIPILANVLINVADGRLTLTATDMEIAVVEEIGAE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQS-------- 112
               G++T  A +LY+I RKL DG  I          E++ + GD+   L++        
Sbjct: 61  TSRNGAVTAPAAVLYEIARKLPDGVAI----------ELDHTGGDAPLALRAGRYATSLN 110

Query: 113 -FPESEFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDL 169
                +FPS       Y F + ++VL+ L++RT FA++TEE RYYLNGI+ H+   +E  
Sbjct: 111 VLDVDDFPSMMAGTLPYHFTMPAAVLRGLIDRTRFAISTEETRYYLNGIYLHVAAGDEGS 170

Query: 170 KLCAVATDGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIH 229
            L AVATDGHRLA  E ++     +MP +IVPRK V E+ ++L      V V LS++RI 
Sbjct: 171 MLRAVATDGHRLARVETEVPPGAEEMPGVIVPRKTVAELRKLLDEGTEDVAVGLSDTRIQ 230

Query: 230 LNIESLSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLS 289
             + +++++ +LIDG FP Y  VIP  NDK LRV   +   AV RV+ +S  R + VKLS
Sbjct: 231 FTVGTVTLTSKLIDGTFPEYDRVIPRGNDKILRVGKRDFSDAVARVAAISQERSRPVKLS 290

Query: 290 LSSDKLCMTVDNPDMGKAIESMN---VYYNECPMDICFNYKYLLEIIDNISSDEVVDDEV 346
           +  + L ++  +PD G A E ++   V Y+  P++I F  +YL +I D I      D +V
Sbjct: 291 IGHNLLTLSAVSPDQGTAKEELDDNYVTYDSTPLEIGFQARYLNDITDQI------DKDV 344

Query: 347 VFRLDSSNSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            F    S++   +R     S         A YVLMPMR+
Sbjct: 345 EFAFSDSSAPTIVRDVASPS---------ALYVLMPMRV 374


>gi|148260438|ref|YP_001234565.1| DNA polymerase III subunit beta [Acidiphilium cryptum JF-5]
 gi|146402119|gb|ABQ30646.1| DNA polymerase III, beta subunit [Acidiphilium cryptum JF-5]
          Length = 374

 Score =  253 bits (646), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 143/399 (35%), Positives = 216/399 (54%), Gaps = 39/399 (9%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+  +R+ +L+ L H   ++E++NTIP+  +VLL   +G L I A+  EI +   + A+
Sbjct: 1   MKLKADRATLLKALAHVQNVVEKRNTIPILANVLLSVKEGRLTIAATDLEIALIEEVAAT 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQS-------- 112
               GS+T  A  LY+IVR+  D A+I          E++   GD+   L++        
Sbjct: 61  TMRDGSVTAPAATLYEIVRRQPDNAEI----------ELDHPGGDAPLALRAGRYATKLV 110

Query: 113 -FPESEFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--L 169
             P  EFP     +  + F + +  L+ L++RT FA++TEE RYYLNGI+ H  E +   
Sbjct: 111 VLPTDEFPKLDAGKLTHRFAVPAQALRGLIDRTRFAISTEETRYYLNGIYLHAAESEGVP 170

Query: 170 KLCAVATDGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIH 229
            L AVATDGHRLA  E  +    A MP +IVPRK V EI ++L      V ++LSE+RI 
Sbjct: 171 VLRAVATDGHRLARVEEPLPEGAAGMPGVIVPRKTVNEIRKLLDEVSGDVSIALSETRIQ 230

Query: 230 LNIESLSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLS 289
             ++++ M+ +LIDG +P+Y  VIP  NDK LRV   +   AV RVS ++S R + VKLS
Sbjct: 231 FELDTMRMTSKLIDGTYPDYSKVIPTGNDKILRVETADFSAAVARVSAITSERNKPVKLS 290

Query: 290 LSSDKLCMTVDNPDMGKAIESMN---VYYNECPMDICFNYKYLLEIIDNISSDEVVDDEV 346
           +  D L ++  +PD G A E ++   V Y   P++I F  +YL ++ + I        +V
Sbjct: 291 VGRDLLVLSATSPDQGTATEELDAEQVEYRATPLEIGFQARYLNDVTEQIKG------KV 344

Query: 347 VFRLDSSNSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            F      +   +R    +S         A +VLMPMR+
Sbjct: 345 EFCFADGAAPTLVRAAGDES---------AIFVLMPMRV 374


>gi|326403632|ref|YP_004283714.1| DNA polymerase III beta subunit [Acidiphilium multivorum AIU301]
 gi|325050494|dbj|BAJ80832.1| DNA polymerase III beta subunit [Acidiphilium multivorum AIU301]
          Length = 374

 Score =  252 bits (644), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 143/399 (35%), Positives = 216/399 (54%), Gaps = 39/399 (9%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+  +R+ +L+ L H   ++E++NTIP+  +VLL   +G L I A+  EI +   + A+
Sbjct: 1   MKLKADRATLLKALAHVQNVVEKRNTIPILANVLLSVKEGRLTIAATDLEIALIEEVAAT 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQS-------- 112
               GS+T  A  LY+IVR+  D A+I          E++   GD+   L++        
Sbjct: 61  TMRDGSVTAPAATLYEIVRRQPDNAEI----------ELDHPGGDAPLALRAGRYATKLV 110

Query: 113 -FPESEFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--L 169
             P  EFP     +  + F + +  L+ L++RT FA++TEE RYYLNGI+ H  E +   
Sbjct: 111 VLPTDEFPKLDAGKLTHRFAVPAQALRGLIDRTRFAISTEETRYYLNGIYLHSAESEGVP 170

Query: 170 KLCAVATDGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIH 229
            L AVATDGHRLA  E  +    A MP +IVPRK V EI ++L      V ++LSE+RI 
Sbjct: 171 VLRAVATDGHRLARVEEPLPEGAAGMPGVIVPRKTVNEIRKLLDEVSGDVSIALSETRIQ 230

Query: 230 LNIESLSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLS 289
             ++++ M+ +LIDG +P+Y  VIP  NDK LRV   +   AV RVS ++S R + VKLS
Sbjct: 231 FELDTMRMTSKLIDGTYPDYSKVIPTGNDKILRVETADFSAAVARVSAITSERNKPVKLS 290

Query: 290 LSSDKLCMTVDNPDMGKAIESMN---VYYNECPMDICFNYKYLLEIIDNISSDEVVDDEV 346
           +  D L ++  +PD G A E ++   V Y   P++I F  +YL ++ + I        +V
Sbjct: 291 VGRDLLVLSATSPDQGTATEELDAEQVEYRATPLEIGFQARYLNDVTEQIKG------KV 344

Query: 347 VFRLDSSNSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            F      +   +R    +S         A +VLMPMR+
Sbjct: 345 EFCFADGAAPTLVRAAGDES---------AIFVLMPMRV 374


>gi|329891033|ref|ZP_08269376.1| DNA polymerase III, beta subunit [Brevundimonas diminuta ATCC
           11568]
 gi|328846334|gb|EGF95898.1| DNA polymerase III, beta subunit [Brevundimonas diminuta ATCC
           11568]
          Length = 372

 Score =  252 bits (643), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 140/388 (36%), Positives = 222/388 (57%), Gaps = 19/388 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++T+ERS +L  LGH   ++ER+NTIP+  +VLL A    L   A+  ++E+     A 
Sbjct: 1   MQLTIERSALLRALGHVQSVVERRNTIPILSNVLLSAGRDRLSFAATDLDMEMVDEAEAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+V G IT  AH LY+IVRKL DGA++S     +    + ++ G S F L   P  +FP 
Sbjct: 61  VNVEGQITAPAHTLYEIVRKLPDGAEVSLTYSGD-DPRLVVAAGRSRFNLPVLPAGDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFH-INEEDLKLC-AVATDG 178
              E     + L    L  L+++T FA++TEE RYYLNG++ H + +  + L  AVATDG
Sbjct: 120 MSTEASGARYTLPKEDLARLIDKTRFAVSTEETRYYLNGLYLHTVADGGIPLLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA+AE       A  P +IVPRK V ++ R+L      V+V +S  +I       S++
Sbjct: 180 HRLALAETPAPEGAAGGPGVIVPRKTVDQVRRLLDDGAGPVEVQVSAQKIRFEFGEASLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  NDK+  ++ +   +AVDRV+ +S+ + ++VKL+  +D++ +T
Sbjct: 240 SKVIDGAFPDYLRVIPKGNDKQADIDNSLFAKAVDRVATISAEKSRSVKLAFDNDRVKLT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRL-DSSNSSV 357
           V N + G+A E + + Y++ P +I FN +YLL++   I+      +   F+  D ++ ++
Sbjct: 300 VRNMEAGQAEEEVEIGYSDEPFEIGFNARYLLDVAGQITG-----ETAHFKFADPASPTL 354

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            +   D          V   YVLMP+R+
Sbjct: 355 VLDPAD----------VGVQYVLMPLRV 372


>gi|58038493|ref|YP_190457.1| DNA polymerase III subunit beta [Gluconobacter oxydans 621H]
 gi|58000907|gb|AAW59801.1| DNA polymerase III, beta chain [Gluconobacter oxydans 621H]
          Length = 374

 Score =  249 bits (635), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 140/390 (35%), Positives = 217/390 (55%), Gaps = 21/390 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  V+R+ +   L H   + E++NTIP+  +VL+   D +L + A+  EI +   +PAS
Sbjct: 1   MKFKVDRTLLQRALAHIHGVAEKRNTIPILANVLMSYQDDVLRLTATDMEIAVVEDVPAS 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
            +  GS TV A +L++IVRKL DG  + F  ++     + +  G     L   P  +FP+
Sbjct: 61  GERSGSTTVPAAVLFEIVRKLPDGVALEFDHQDS-EAPLALRAGRYATSLNVLPVDDFPA 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED--LKLCAVATDG 178
               +  + F + ++ L+ L++RT FA++ EE RYYLNGI+ H+ E      L AVATDG
Sbjct: 120 MVAGDLPHRFSIPAATLRGLIDRTKFAISNEETRYYLNGIYLHVAENGSIPMLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA  E ++      MP +I+PRK + E+ ++L    + ++VSLS++RI      + ++
Sbjct: 180 HRLARVETELPEGARGMPGVIIPRKTINELRKLLDEGAADLEVSLSDTRIQFQAGPVLLT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP Y+ VIP  ND+ LRV   +   AV RV+ +S  R + VKLS++ + L ++
Sbjct: 240 SKLIDGTFPEYERVIPKGNDRILRVGKRDFAAAVGRVAAISQERSRPVKLSVTQNMLNLS 299

Query: 299 VDNPDMGKAIESMN---VYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNS 355
             +PD G A E ++   V Y+  P++I F  +YL +I D I      D EV F    S++
Sbjct: 300 ATSPDQGVAHEELDENAVSYDAAPIEIGFQARYLTDITDQI------DVEVEFAFSDSSA 353

Query: 356 SVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
              +R     S         A YVLMPMR+
Sbjct: 354 PTIVRDTASPS---------ALYVLMPMRV 374


>gi|197106929|ref|YP_002132306.1| DNA polymerase III, beta subunit [Phenylobacterium zucineum HLK1]
 gi|196480349|gb|ACG79877.1| DNA polymerase III, beta subunit [Phenylobacterium zucineum HLK1]
          Length = 372

 Score =  248 bits (634), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 136/387 (35%), Positives = 216/387 (55%), Gaps = 17/387 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+T+ER+ +L  LGH    +ER+NTIP+  +VLL A    L   A+  ++EI     A 
Sbjct: 1   MKLTIERAALLRALGHVQSAVERRNTIPILSNVLLSAERDRLTFSATDLDMEIIDEAMAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           VD  G IT  AH LY+IVRKL +GA +S     E    + +  G S F L   P  +FP 
Sbjct: 61  VDQPGQITAPAHTLYEIVRKLPEGADVSLSFTGE-DPRLAVQAGRSRFNLPVLPAGDFPV 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFH--INEEDLKLCAVATDG 178
              E +     +  + L  L+++T FA++ EE RYYLNG++ H  + +   +L AVATDG
Sbjct: 120 MSAEGFSGRMGVDVTDLIRLIDKTRFAISAEETRYYLNGLYLHTIVVDGSPRLRAVATDG 179

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
            RLA+A++      A  P +IVPRK VGE  R+L      V++ +S  +I    +  +++
Sbjct: 180 SRLALADMPAPEGAAGAPGVIVPRKTVGEARRLLEDAGEQVELQVSPQKIRFEFDGAALT 239

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG FP+Y  VIP  N++ + V+     QAVDRV+ +S+ + ++V++++ + K+ +T
Sbjct: 240 SKVIDGNFPDYARVIPKDNNRIVMVDAKLFAQAVDRVATISAEKSRSVRMAIEAGKVVLT 299

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V N + G+A+E + + Y+  P ++ FN +YLL+I D IS      ++   R    N    
Sbjct: 300 VRNMEAGQAVEELEIDYDGEPFELSFNARYLLDITDQISG-----EQAELRFGGPNDPAL 354

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +        +  D  V   Y+LMP+R+
Sbjct: 355 V-------LDPADADVQ--YILMPLRV 372


>gi|16124411|ref|NP_418975.1| DNA polymerase III subunit beta [Caulobacter crescentus CB15]
 gi|221233094|ref|YP_002515530.1| DNA polymerase III subunit beta [Caulobacter crescentus NA1000]
 gi|239977224|sp|B8GXP6|DPO3B_CAUCN RecName: Full=DNA polymerase III subunit beta
 gi|239977225|sp|P0CAU5|DPO3B_CAUCR RecName: Full=DNA polymerase III subunit beta
 gi|1049324|gb|AAB51448.1| DNA polymerase III beta subunit [Caulobacter crescentus CB15]
 gi|13421269|gb|AAK22143.1| DNA polymerase III, beta subunit [Caulobacter crescentus CB15]
 gi|220962266|gb|ACL93622.1| DNA polymerase III, beta chain [Caulobacter crescentus NA1000]
          Length = 372

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 140/389 (35%), Positives = 225/389 (57%), Gaps = 21/389 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+T+ER+ +L+ LGH   ++ER+NTIP+  ++LL A    L   A+  ++EI     A 
Sbjct: 1   MKLTIERAALLKALGHVQSVVERRNTIPILSNILLSAEGDRLSFSATDLDMEIIDEGFAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESEFP 119
           +DV G IT  AH LY+IVRKL DGA +S  F  ++    + I  G S F L   P  +FP
Sbjct: 61  IDVPGQITAPAHTLYEIVRKLPDGADVSLSFSGDD--PRLVIQAGRSRFNLPVLPAGDFP 118

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFH-INEE-DLKLCAVATD 177
               +       + ++ L  L+++T FA++TEE RYYLNG++ H +NE  + KL AVATD
Sbjct: 119 VMSSDGLSSRIAVDTNELIRLIDKTRFAISTEETRYYLNGLYVHTVNEGGETKLRAVATD 178

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLA+AE+        +P +IVPRK + E  R++ S   +V + +S  ++     + ++
Sbjct: 179 GHRLALAEMPAPEGAVGIPGVIVPRKTIAEARRLMESAGETVDLQVSPQKVRFEFGAAAL 238

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + ++IDG FP+Y  VIP  N K L ++     +AVDRV+ +S+ + ++VKL++   ++ +
Sbjct: 239 TSKVIDGAFPDYMRVIPRDNAKILTLDNDLFAKAVDRVATISAEKSRSVKLAVEPGRITL 298

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRL-DSSNSS 356
           TV N + G+A+E + V Y+  P +I FN +YLL++   I+       +  FR  D ++ +
Sbjct: 299 TVRNMEAGQAVEEVEVDYDGEPFEIGFNARYLLDVCGQIAG-----PQAEFRFADPASPT 353

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +   D   K          YVLMP+R+
Sbjct: 354 LVVDPVDPGVK----------YVLMPLRV 372


>gi|254490238|ref|ZP_05103428.1| DNA polymerase III, beta subunit [Methylophaga thiooxidans DMS010]
 gi|224464585|gb|EEF80844.1| DNA polymerase III, beta subunit [Methylophaga thiooxydans DMS010]
          Length = 367

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 137/385 (35%), Positives = 224/385 (58%), Gaps = 18/385 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ TV +  I+  L   C I+ER+ T+P+  +VLL+ +   L + ++  E+E+   +P S
Sbjct: 1   MQFTVSQETIVRPLQLVCSIVERRATLPILSNVLLRVHGNQLSMTSTDMELEMIATLPVS 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G ITVSA    DIVR L   A IS    N    +  +  G S F L + P  +FP 
Sbjct: 61  VEEEGKITVSARKFLDIVRALPGNATISL---NAKDNKAVVKAGKSRFSLSTLPSDDFPD 117

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
           ++   Y+    L  S LK+L++ T FAMA++++RYYLNG+      E+  L AVATDGHR
Sbjct: 118 SEGANYIDEISLPQSALKSLLDETSFAMASQDVRYYLNGLLLE--REETTLRAVATDGHR 175

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LA+  +     +A+  S+IVPRKA+ E+ R+L+  D  VK++ S  +I + +  +  + +
Sbjct: 176 LAMGSLTTANPVAEKNSVIVPRKAIIELGRLLNETDDDVKLAFSNQQIKVELPDIHFTSK 235

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDG+FPNY+ V+P   DKE+      L+QA+ R +I+S+ + ++V+++L +D+L  TV 
Sbjct: 236 LIDGQFPNYERVLPLGGDKEVLAERDELKQALSRAAILSNDKHRSVRINLDTDQLKATVT 295

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           N +   A E ++V Y   P++I FN  YLL++++ I  ++V   +++F  ++S++ V   
Sbjct: 296 NQEQESAEEEISVDYKGSPLEIAFNNAYLLDLLNAIPDEKV---KILFTDETSSALV--- 349

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
                     D K    YV+MPMR+
Sbjct: 350 -------TPADQKFERQYVVMPMRL 367


>gi|296115230|ref|ZP_06833871.1| DNA polymerase III subunit beta [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978331|gb|EFG85068.1| DNA polymerase III subunit beta [Gluconacetobacter hansenii ATCC
           23769]
          Length = 374

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 143/399 (35%), Positives = 222/399 (55%), Gaps = 39/399 (9%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+  +R+ +L+ L H   + E++NTIP+  +VL+   DGL+ + A+  EI +   I A 
Sbjct: 1   MKLKADRATLLKALLHIQGVAEKRNTIPILANVLINVTDGLMTMTATDMEIAVVEGISAE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQS--FPES-- 116
               G++T  A +L DIVR+L DGA +          E++ + GD+   L++  F  S  
Sbjct: 61  TLRDGAVTAPAAVLCDIVRRLPDGAVV----------ELDQAGGDAPLALRAGRFSTSLN 110

Query: 117 -----EFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINE--EDL 169
                +FPS       + F +AS  L+ L++R+ FA++TEE RYYLNGI+FH+ E  +  
Sbjct: 111 VLDVDDFPSMMAGALPHDFTIASQALRGLIDRSRFAISTEETRYYLNGIYFHVAETPQGP 170

Query: 170 KLCAVATDGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIH 229
            L AVATDGHRLA  E D+    A MP +I+PRK V E+ ++L      + ++LS++RI 
Sbjct: 171 MLRAVATDGHRLARVETDLPDGAAGMPGVIIPRKTVNELRKLLEEGPEHIGIALSDTRIQ 230

Query: 230 LNIESLSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLS 289
             + ++ ++ +LIDG FP Y+ VIP  NDK L V       AV RV+ +S  R + VKL+
Sbjct: 231 FTVGNVILTSKLIDGTFPEYERVIPTGNDKVLHVGKKIFSDAVSRVAAISQERSRPVKLA 290

Query: 290 LSSDKLCMTVDNPDMGKAIESMN---VYYNECPMDICFNYKYLLEIIDNISSDEVVDDEV 346
           ++ + L ++  + D G A E ++   V Y+  P++I F  +YL +I D I  +      V
Sbjct: 291 VTQNLLTLSAASQDQGTATEELDDTHVVYDASPIEIGFQARYLNDITDQIEKN------V 344

Query: 347 VFRLDSSNSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            F    S++   +R  D+ S         A YVLMPMR+
Sbjct: 345 EFAFSDSSAPTIVRDVDRPS---------ALYVLMPMRV 374


>gi|167644134|ref|YP_001681797.1| DNA polymerase III subunit beta [Caulobacter sp. K31]
 gi|167346564|gb|ABZ69299.1| DNA polymerase III, beta subunit [Caulobacter sp. K31]
          Length = 372

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 137/389 (35%), Positives = 223/389 (57%), Gaps = 21/389 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+T+ER+ +L+ LGH   ++ER+NTIP+  ++LL A+   L   A+  ++EI     A 
Sbjct: 1   MKLTIERAALLKALGHVQSVVERRNTIPILSNILLSADRDTLSFSATDLDMEIIDEGLAQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESEFP 119
           +D+ G IT  AH LY+IVRKL DG+ +S  F  ++    + I  G S F L   P  +FP
Sbjct: 61  IDIPGQITAPAHTLYEIVRKLPDGSDVSLSFSGDD--PRLVIQAGRSRFNLPVLPAGDFP 118

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHI--NEEDLKLCAVATD 177
               +       + ++ L  L+++T FA++TEE RYYLNG++ H   +  ++KL AVATD
Sbjct: 119 VMSSDGLSGRISVDTNELIRLIDKTRFAISTEETRYYLNGLYLHTVNDGGEVKLRAVATD 178

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLA+AE+      A +P IIVPRK + E  R++ S    V + +S  ++       ++
Sbjct: 179 GHRLALAEMAAPEGAAGLPGIIVPRKTIQEARRLMESAGEQVDLQISAQKVRFEFGRAAL 238

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + ++IDG FP+Y  VIP  N K L ++     +AVDRV+ +S+ + ++VKL++   ++ +
Sbjct: 239 TSKVIDGAFPDYLRVIPRDNAKILTLDNDLFAKAVDRVATISAEKSRSVKLAVEPGRITL 298

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRL-DSSNSS 356
           TV N + G+A+E + V Y+    +I FN +YLL++   I    + +    FR  D ++ +
Sbjct: 299 TVRNMEAGQAVEEVEVDYDGEAFEIGFNARYLLDVCGQIGG-PIAE----FRFADPASPT 353

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +   D   K          YVLMP+R+
Sbjct: 354 LVVDPTDPGVK----------YVLMPLRV 372


>gi|306843604|ref|ZP_07476205.1| DNA polymerase III, beta subunit [Brucella sp. BO1]
 gi|306276295|gb|EFM57995.1| DNA polymerase III, beta subunit [Brucella sp. BO1]
          Length = 275

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 126/289 (43%), Positives = 180/289 (62%), Gaps = 16/289 (5%)

Query: 99  VNISHGDSNFYLQSFPESEFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLN 158
           +++  G S+F LQ  P+S+FP      + +SF + +  LK L++RT FA++TEE RYYLN
Sbjct: 1   MSVISGKSSFRLQCLPQSDFPELTAGAFTHSFRIEAQALKRLIDRTQFAISTEETRYYLN 60

Query: 159 GIFFHINEED--LKLCAVATDGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKD 216
           GIFFH  E D  LKL AVATDGHRLA AE++  +    MP II+PRK V E+ +++   D
Sbjct: 61  GIFFHAIESDGALKLRAVATDGHRLARAELEAPSGTEGMPGIIIPRKTVAELQKLVDVPD 120

Query: 217 SSVKVSLSESRIHLNIESLSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVS 276
             V V LS+++I   + S+ ++ +LIDG FP+YQ VIP  NDK+L ++  +   +VDRVS
Sbjct: 121 VVVTVELSDAKIRFTVGSVVLTSKLIDGTFPDYQRVIPSGNDKKLTIDRQDFAASVDRVS 180

Query: 277 IMSSVRIQAVKLSLSSDKLCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNI 336
            +SS R +AVKLS++  +L +TV+NPD G A + +   Y+  P+DI FN KYLL+I   +
Sbjct: 181 TISSERGRAVKLSIADGQLTLTVNNPDSGSATDELAADYDGDPLDIGFNSKYLLDITGQL 240

Query: 337 SSDEVVDDEVVFRLDSSNSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           S       + VF L  + S   +R       +  D  V   YVLMPMR+
Sbjct: 241 SG-----TDAVFMLADAGSPTLVR-------DTGDEDV--LYVLMPMRV 275


>gi|56459114|ref|YP_154395.1| DNA polymerase sliding clamp subunit [Idiomarina loihiensis L2TR]
 gi|56178124|gb|AAV80846.1| DNA polymerase sliding clamp subunit [Idiomarina loihiensis L2TR]
          Length = 367

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 137/386 (35%), Positives = 220/386 (56%), Gaps = 20/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK ++ R   L+ L      +ER++T+P+  ++LLQ ++G L++  +  E+E+  A+P  
Sbjct: 1   MKFSINRDAFLKPLQVVSGAVERRHTLPILSNLLLQVDNGQLKLTGTDLEVELVSAVPLE 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
           S D+  ++TV A  L DIVR L +G+ I F  + +  T   +  G S F L +    +FP
Sbjct: 61  SADMDAAVTVPAKKLLDIVRSLPEGSTIEFTSQEDSAT---VKSGRSKFKLSTLSSDDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +         +VLK+L+ +THF+MA +++RYYLNG+ F  +   L+  +VATDGH
Sbjct: 118 NIDDWKSDIHLVTEQAVLKDLMLKTHFSMANQDVRYYLNGMLFETDNGMLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA++   I         +IVPRK V E+LR+L   D  V VS+  + I +    L  + 
Sbjct: 176 RLAMSTCAIDQPGLAQRQVIVPRKGVVELLRLLGDDDQEVSVSIGNNHIRVETPELVFTS 235

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P   DK +  +   LRQ+  R SI+S+ + + V+L+LSS +LC+T 
Sbjct: 236 KLVDGRFPDYRRVLPSGGDKVIVAHRDALRQSFGRASILSNEKFRGVRLNLSSGELCITA 295

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
            NP+  +A E + V Y    ++I FN  YLL++++NI      D++V F L  SNSS  I
Sbjct: 296 TNPEQEQAEEVIEVDYQGDDLEIGFNVSYLLDVLNNID-----DEQVSFTLSDSNSSALI 350

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +  +S           YV+MPMR+
Sbjct: 351 EPQHDES---------CCYVIMPMRL 367


>gi|306842703|ref|ZP_07475346.1| DNA polymerase III, beta subunit [Brucella sp. BO2]
 gi|306287149|gb|EFM58651.1| DNA polymerase III, beta subunit [Brucella sp. BO2]
          Length = 275

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 126/289 (43%), Positives = 179/289 (61%), Gaps = 16/289 (5%)

Query: 99  VNISHGDSNFYLQSFPESEFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLN 158
           +++  G S+F LQ  P+S+FP      + +SF + +  LK L++RT FA++TEE RYYLN
Sbjct: 1   MSVISGKSSFRLQCLPQSDFPELTAGAFTHSFRIDAQALKRLIDRTQFAISTEETRYYLN 60

Query: 159 GIFFHINEED--LKLCAVATDGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKD 216
           GIFFH  E D  LKL AVATDGHRLA AE++  +    MP II+PRK V E+ +++   D
Sbjct: 61  GIFFHAIESDGALKLRAVATDGHRLARAELEAPSGTEGMPGIIIPRKTVAELQKLVDVPD 120

Query: 217 SSVKVSLSESRIHLNIESLSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVS 276
             V V LS+++I   + S+ ++ +LIDG FP+YQ VIP  NDK+L ++      +VDRVS
Sbjct: 121 VVVTVELSDAKIRFTVGSVVLTSKLIDGTFPDYQRVIPSGNDKKLTIDRQGFAASVDRVS 180

Query: 277 IMSSVRIQAVKLSLSSDKLCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNI 336
            +SS R +AVKLS++  +L +TV+NPD G A + +   Y+  P+DI FN KYLL+I   +
Sbjct: 181 TISSERGRAVKLSIADGQLTLTVNNPDSGSATDELAADYDGDPLDIGFNSKYLLDITSQL 240

Query: 337 SSDEVVDDEVVFRLDSSNSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           S       + VF L  + S   +R       +  D  V   YVLMPMR+
Sbjct: 241 SG-----TDAVFMLADAGSPTLVR-------DTGDEDV--LYVLMPMRV 275


>gi|284007064|emb|CBA72339.1| DNA polymerase III subunit beta [Arsenophonus nasoniae]
          Length = 366

 Score =  233 bits (594), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 133/386 (34%), Positives = 221/386 (57%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK T+ER  +L+ L      +  + T+P+  ++LLQ ++ +L +  +  E+E+   +   
Sbjct: 1   MKFTIEREQLLKPLQQVSGPLGGRPTLPILGNLLLQVSENILSLTGTDLEVEMVAKVTLT 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                GSITV A   +DI R L DGA+I    E   G  + +  G S F L + P ++FP
Sbjct: 61  QPGESGSITVPARKFFDIWRGLPDGAEIKVTLE---GDRLLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    FEL  + LK L+E T F+MA +++RYYLNG+ F    ++L+   VATDGH
Sbjct: 118 NLDDWQSEVEFELPQATLKRLIEATQFSMAHQDVRYYLNGMLFETEGQELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  ++I   +    S+IVPRK V E +R+L S D S+K+ +  + I  ++     + 
Sbjct: 176 RLAVCSLNIDKDLPTH-SVIVPRKGVVEFMRLLDSSDESLKLQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L  +C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLTADCDKLKQAFSRAAILSNEKFRGVRLYISENQLRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  ++ E ++V Y    ++I FN  Y+L++++ +       ++V   L  SNSSV I
Sbjct: 295 NNPEQEESEEIVDVNYQSPMIEIGFNVSYILDVLNTLKC-----EQVNLLLTDSNSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
               +D+  N      A YV+MPMR+
Sbjct: 350 ----EDAATNA-----AAYVVMPMRL 366


>gi|88860615|ref|ZP_01135252.1| DNA polymerase III, beta-subunit [Pseudoalteromonas tunicata D2]
 gi|88817210|gb|EAR27028.1| DNA polymerase III, beta-subunit [Pseudoalteromonas tunicata D2]
          Length = 368

 Score =  233 bits (594), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 130/386 (33%), Positives = 224/386 (58%), Gaps = 20/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+IT+ R   L+ L      IERK+T+P+  +VLL+  DG L +  +  EIE+   +  S
Sbjct: 2   MQITIPRDQFLKPLIQVSGAIERKHTLPILSNVLLEIADGKLMMTGTDLEIELVACVTLS 61

Query: 61  VDVCGS-ITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
             V  S +T+ A  L DI + L DG++I+   ++   ++V ++ G S F L S P  +FP
Sbjct: 62  HFVEDSKLTLPAKKLLDICKSLPDGSEITLSAQD---SQVLLTSGKSRFSLASLPALDFP 118

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +    F++  + L+ L+E THF+MA +++RYYLNG+ F ++  ++K   VATDGH
Sbjct: 119 NLEQWDGEVDFQITRNELRKLLESTHFSMANQDVRYYLNGMSFEVDNSEIK--TVATDGH 176

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA+++  +   +     +I+PRK V EI+R++ S D+ V +    +   +  +  + + 
Sbjct: 177 RLALSQKKLDYSLNTQRQLIIPRKGVQEIMRLMVSDDNLVTIQFGANHFRIIDQEFTFTS 236

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P   DK +  N   LR A  RVSI+S+ + + V+L+ S+ +L +T 
Sbjct: 237 KLVDGRFPDYRRVLPRGGDKVVTANREWLRSAFSRVSILSNEKFRGVRLNFSAGELKITA 296

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E + V Y+   ++I FN  Y+L++++ + +     ++V F L  SNSS  +
Sbjct: 297 NNPEQEQAEEIVEVVYSGPDLEIGFNVSYVLDVLNTLKT-----EDVSFTLSDSNSSALV 351

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
            G   D          A YV+MPMR+
Sbjct: 352 EGTGDD---------EAMYVVMPMRL 368


>gi|85711020|ref|ZP_01042081.1| DNA polymerase sliding clamp subunit [Idiomarina baltica OS145]
 gi|85695424|gb|EAQ33361.1| DNA polymerase sliding clamp subunit [Idiomarina baltica OS145]
          Length = 367

 Score =  233 bits (593), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 136/386 (35%), Positives = 217/386 (56%), Gaps = 20/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPA- 59
           MK TV R   L+ L      +ER++T+P+  ++LL+     L +  +  E+E+  ++   
Sbjct: 1   MKFTVSRDAFLKPLQIVSGAVERRHTLPILSNLLLKVEGDTLRLTGTDLEVELISSVKVE 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
           S    G +TV A  L DIVR L D + I    ++E    V +  G S F L S    +FP
Sbjct: 61  SSGGDGMVTVPAKKLLDIVRSLPDESPIELVGDDE---GVRVRSGRSKFKLSSLSADDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++     +F  +   LK L+E+THF+MA +++RYYLNG+ F  +   L+  +VATDGH
Sbjct: 118 NIEDWSSEVNFITSQDTLKRLMEKTHFSMANQDVRYYLNGMLFETDANMLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA++   I         +IVPRK V E+LR+L+  DS V V++  + I +    +  + 
Sbjct: 176 RLAMSNCHIEQPGLSQRQVIVPRKGVVELLRLLNEDDSEVAVAIGNNHIRVETADIVFTS 235

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P   DK++  +   LRQA  R SI+S+ + + V+L++++ +LC+T 
Sbjct: 236 KLVDGRFPDYRRVVPQGGDKQIFADRDLLRQAFGRASILSNEKFRGVRLNITAGELCITA 295

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
            NP+  +A E + V Y    ++I FN  YLL++++NI +     +EV F L  +NSS  I
Sbjct: 296 TNPEQEQAEEVIEVNYEGEAIEIGFNVSYLLDVLNNIEA-----EEVCFVLSDANSSALI 350

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             KD DS           YV+MPMR+
Sbjct: 351 EPKDDDS---------CCYVVMPMRL 367


>gi|194363780|ref|YP_002026390.1| DNA polymerase III subunit beta [Stenotrophomonas maltophilia
           R551-3]
 gi|194346584|gb|ACF49707.1| DNA polymerase III, beta subunit [Stenotrophomonas maltophilia
           R551-3]
          Length = 366

 Score =  232 bits (592), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 126/385 (32%), Positives = 217/385 (56%), Gaps = 19/385 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ T++R   L+ L     ++ER+ T+PV  + L+Q  +G L +  +  E+E+   I   
Sbjct: 1   MRFTLQREAFLKPLAQVVNVVERRQTLPVLANFLVQVQNGQLSLTGTDLEVEMVSRIAVE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               G  T+ A  L++I+R L DG++I+    ++ G ++ +  G S F L + P ++FPS
Sbjct: 61  DAQDGETTIPARKLFEIIRALPDGSRITV---SQTGDKITVQAGRSRFTLATLPSNDFPS 117

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
             E E      +  + LK L+ERT FAMA +++RYYLNG+ F +  + L+   VATDGHR
Sbjct: 118 VDEVEATERVAIGEATLKELIERTAFAMAQQDVRYYLNGLLFDLRGDALR--TVATDGHR 175

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LA+ E D+         IIVPRK V E+ R+L S D  +++ +  S + +  + ++ + +
Sbjct: 176 LALCETDLAKPSGSKRQIIVPRKGVTELQRLLESGDREIELEVGRSHVRVKRDDVTFTSK 235

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDG FP+Y+ VIP   D+E++VN  +LR ++ R +I+S+ + + +++ +S   L ++  
Sbjct: 236 LIDGRFPDYEAVIPIGADREVKVNRESLRASLQRAAILSNEKYRGIRVEVSPGNLKISAH 295

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           NP+  +A E +        + I FN  YLL+ +  +      D+EV+ +L  SNSS  +R
Sbjct: 296 NPEQEEAQEEIEADTTVSDLAIGFNVNYLLDALSALR-----DEEVIIQLRDSNSSALVR 350

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
               +S + K       +V+MP+R+
Sbjct: 351 ----ESSSEKSR-----HVVMPLRL 366


>gi|190572093|ref|YP_001969938.1| DNA polymerase III subunit beta [Stenotrophomonas maltophilia
           K279a]
 gi|254521676|ref|ZP_05133731.1| DNA polymerase III, beta subunit [Stenotrophomonas sp. SKA14]
 gi|190010015|emb|CAQ43620.1| putative DNA polymerase III beta subunit [Stenotrophomonas
           maltophilia K279a]
 gi|219719267|gb|EED37792.1| DNA polymerase III, beta subunit [Stenotrophomonas sp. SKA14]
          Length = 366

 Score =  230 bits (586), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 125/385 (32%), Positives = 216/385 (56%), Gaps = 19/385 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ T++R   L+ L     ++ER+ T+PV  + L+Q  +G L +  +  E+E+   I   
Sbjct: 1   MRFTLQREAFLKPLAQVVNVVERRQTLPVLANFLVQVQNGQLSLTGTDLEVEMVSRIAVE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               G  T+ A  L++I+R L DG++I+    ++ G ++ +  G S F L + P ++FPS
Sbjct: 61  DAQDGETTIPARKLFEIIRALPDGSRITV---SQTGDKITVQAGRSRFTLATLPSNDFPS 117

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
             E E      +  + LK L+ERT FAMA +++RYYLNG+ F +  + L+   VATDGHR
Sbjct: 118 VDEVEATERVAIGEATLKELIERTAFAMAQQDVRYYLNGLLFDLRGDALR--TVATDGHR 175

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LA+ E D+         IIVPRK V E+ R+L S D  +++ +  S + +  + ++ + +
Sbjct: 176 LALCETDLAKPSGSKRQIIVPRKGVTELQRLLESGDREIELEVGRSHVRVKRDDVTFTSK 235

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDG FP+Y+ VIP   D+E++V+   LR ++ R +I+S+ + + +++ +S   L ++  
Sbjct: 236 LIDGRFPDYEAVIPIGADREVKVDREALRASLQRAAILSNEKYRGIRVEVSPGNLKISAH 295

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           NP+  +A E +        + I FN  YLL+ +  +      D+EV+ +L  SNSS  +R
Sbjct: 296 NPEQEEAQEEIEADTTVSDLAIGFNVNYLLDALSALR-----DEEVIIQLRDSNSSALVR 350

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
               +S + K       +V+MP+R+
Sbjct: 351 ----ESSSEKSR-----HVVMPLRL 366


>gi|120552946|ref|YP_957297.1| DNA polymerase III, beta subunit [Marinobacter aquaeolei VT8]
 gi|120322795|gb|ABM17110.1| DNA polymerase III, beta subunit [Marinobacter aquaeolei VT8]
          Length = 367

 Score =  229 bits (585), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 128/386 (33%), Positives = 218/386 (56%), Gaps = 20/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAI-PA 59
           MK+T+ R  ++  L     ++E+K T+PV  +VLL+A D  L +  +  E+E+   + P 
Sbjct: 1   MKLTISRESLITPLQSIAGVVEKKQTMPVLSNVLLEAEDNTLTLTGTNMEVELVARVAPV 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            VD  G ITV A  L DI R L D A I    E   G  +++  G+S+F L + P   FP
Sbjct: 61  HVDQPGRITVPARKLADICRALGDEAPIDLALE---GDRLHLRSGNSHFTLSTLPAEHFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++E   +   L    L  +++ T FAMA +++RYYLNG+   ++    ++  VATDGH
Sbjct: 118 NVEDEPESFRLALPQKELGRMLDATAFAMAQQDVRYYLNGLLLEVDVNHARV--VATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA+A++D+     ++  +IVPRK V E+ R+L  ++S V + + ++ +   + S + + 
Sbjct: 176 RLAMAQLDLDTGCPELRQVIVPRKGVLELARLLDDEESPVTLVIGDNHLRATVGSYTFTS 235

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +LI+G+FP+Y  VIP   DK +  + + L+  + R  I+S   I+ V+L+LS ++L +  
Sbjct: 236 KLIEGKFPDYNRVIPRGGDKTVLADRSTLKSTLQRAGILSHENIRGVRLNLSPNQLQVFA 295

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NPD  +A +++ V Y    + I FN  YL+++++ +      DD+V   L + NSS  I
Sbjct: 296 NNPDQEQAEDALPVEYQGESLQIGFNVGYLVDVMNALD-----DDQVKITLSNPNSSALI 350

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             ++       DN+    YV+MPMR+
Sbjct: 351 EAQN-------DNR--CLYVVMPMRL 367


>gi|37524034|ref|NP_927378.1| DNA polymerase III subunit beta [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36783457|emb|CAE12297.1| DNA polymerase III, beta chain [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 366

 Score =  229 bits (585), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 135/387 (34%), Positives = 220/387 (56%), Gaps = 23/387 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  +ER  +L+ L      +  + T+P+  ++LLQ  +G L +  +  E+E+   +  S
Sbjct: 1   MKFIIEREQLLKPLQQVSSPLSGRPTLPILGNLLLQVTEGSLLLTGTDLEMEMMARVTLS 60

Query: 61  VD-VCGSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEF 118
           +    G+ TV A   +DI R L DGA+IS     EL G  + +  G S F L + P S+F
Sbjct: 61  LPHEVGATTVPARKFFDIWRGLPDGAEISV----ELDGDRLLVRSGRSRFSLSTLPASDF 116

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P+  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDG
Sbjct: 117 PNLDDWQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDG 174

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLAV  + I  ++    S+IVPRK V E++R+L   D+ +++ +  + I  ++     +
Sbjct: 175 HRLAVCSMGIGQKLPSH-SVIVPRKGVIELMRLLDGGDTPLQLQIGSNNIRAHVGDFIFT 233

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +L+DG FP+Y+ V+P + DK L  NC  L+QA  R +I+S+ + + V+L  S ++L +T
Sbjct: 234 SKLVDGRFPDYRRVLPKNPDKTLEANCDMLKQAFSRAAILSNEKFRGVRLYFSENQLRIT 293

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
            +NP+  +A E ++V Y    M+I FN  Y+L++++ +       +EV   L  + SSV 
Sbjct: 294 ANNPEQEEAEEIVDVSYQGAEMEIGFNVSYVLDVLNTLRC-----EEVRLLLTDAISSVQ 348

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           I    +D  N+     NA YV+MPMR+
Sbjct: 349 I----EDCANH-----NAAYVVMPMRL 366


>gi|319785622|ref|YP_004145097.1| DNA polymerase III subunit beta [Pseudoxanthomonas suwonensis 11-1]
 gi|317464134|gb|ADV25866.1| DNA polymerase III, beta subunit [Pseudoxanthomonas suwonensis
           11-1]
          Length = 366

 Score =  229 bits (585), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 131/387 (33%), Positives = 216/387 (55%), Gaps = 23/387 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ T++R  +L+ L     ++ER+ T+PV  + L+Q  DG L +  +  E+E+       
Sbjct: 1   MRFTLQREALLKPLAQVVNVVERRQTLPVLANFLVQVQDGQLSLTGTDLEVEMIARAAVE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
             V G IT+ A  L++IVR L DG++++    +  G +V +  G S F L + P ++FPS
Sbjct: 61  DAVDGEITIPARKLFEIVRALPDGSRVTI---SLAGDKVTVQAGRSRFSLATLPANDFPS 117

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
             E E      +  + LK L+ERT FAMA +++RYYLNG+ F + ++ L+ C VATDGHR
Sbjct: 118 VDEVEATERITVPEAALKELIERTAFAMAQQDVRYYLNGLLFDLRDQSLR-C-VATDGHR 175

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LA+ E  +   +     IIVPRK V E+ R+L   D S+++ +  S I +  + +S + +
Sbjct: 176 LALCEAPLEQPVGTKRQIIVPRKGVTELQRLLEGGDRSLELEVGRSHIRVKRDDVSFTSK 235

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDG FP+Y+ VIP   +KE+RV+   +R A+ R +I+S+ + + V++ +S  +L +   
Sbjct: 236 LIDGRFPDYEAVIPIGAEKEVRVDREVIRAALQRAAILSNEKYRGVRVEISPGQLKINAH 295

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           NP+  +A E +        + I FN  YLL+ +  +      D+ +V  L  +NSS  +R
Sbjct: 296 NPEQEEAQEEIEAETKVDGLAIGFNVNYLLDALGALR-----DEHIVIALRDANSSALVR 350

Query: 361 --GKDKDSKNNKDNKVNAFYVLMPMRI 385
             G DK             +V+MP+R+
Sbjct: 351 EAGSDK-----------CRHVVMPLRL 366


>gi|320539855|ref|ZP_08039514.1| DNA polymerase III, beta subunit [Serratia symbiotica str. Tucson]
 gi|320030041|gb|EFW12061.1| DNA polymerase III, beta subunit [Serratia symbiotica str. Tucson]
          Length = 366

 Score =  227 bits (579), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 132/386 (34%), Positives = 221/386 (57%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  VER  +L+ L      +  + T+P+  ++LLQA +G L +  +  E+E+   +  S
Sbjct: 1   MKFIVEREHLLKPLQQVSSPLGGRPTLPILGNLLLQAMEGSLLLTGTDLEMEMVARVALS 60

Query: 61  -VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   ENE    + +  G S F L + P ++FP
Sbjct: 61  QTHEAGATTVPARKFFDICRGLPEGAEIAVTLENE---RILVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   +ATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATLKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TIATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q+    S+IVPRK V E+LR+L S D+ +++ +  + I  ++     + 
Sbjct: 176 RLAVCSMPIGQQLPSH-SVIVPRKGVMELLRLLDSGDTPLQLQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L  S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKILEAGCDLLKQAFARAAILSNEKFRGVRLYASHNQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y+   M+I FN  Y+L++++ + S+ V       RL  ++S   +
Sbjct: 295 NNPEQEEAEEILDVSYDGTEMEIGFNVSYVLDVLNALKSENV-------RLLLTDSVSSV 347

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +D  S+        A YV+MPMR+
Sbjct: 348 QIEDGVSQ-------AAAYVVMPMRL 366


>gi|156972778|ref|YP_001443685.1| DNA polymerase III subunit beta [Vibrio harveyi ATCC BAA-1116]
 gi|156524372|gb|ABU69458.1| hypothetical protein VIBHAR_00443 [Vibrio harveyi ATCC BAA-1116]
          Length = 366

 Score =  226 bits (577), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 123/386 (31%), Positives = 219/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ERS +++ L      +  + T+P+  ++LL+  + +L + A+  E+E+   +   
Sbjct: 1   MKFTIERSHLIKPLQQVSGALGGRPTLPILGNLLLKVEENVLSMTATDLEVELVSKVTLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D   GSITV +    DI R L D + I+F  E   G  V +  G S F L + P ++FP
Sbjct: 61  GDFEAGSITVPSRKFLDICRGLPDDSIITFVLE---GDRVQVRSGRSRFSLATLPANDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +      L  S L+ L+E+T F+MA +++RYYLNG+ F I+   L+  +VATDGH
Sbjct: 118 NIEDWQSEVEVSLTQSDLRTLIEKTQFSMANQDVRYYLNGMLFEIDGTTLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AV++  + A  A+   IIVPRK V E+++++ + +  V + +  S +   + +   + 
Sbjct: 176 RMAVSQTQLGADFAQ-KQIIVPRKGVQELVKLMDAPEQPVVLQIGSSNVRAEVNNFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P S +K L   C  LRQA  R +I+S+ + + V+++L+  ++ +T 
Sbjct: 235 KLVDGRFPDYRRVLPQSTNKTLETGCDELRQAFSRAAILSNEKFRGVRVNLAGSEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V +    ++I FN  Y+L++++ +       D V   +  +N+S  I
Sbjct: 295 NNPEQEEAEEMLDVTFEGDAIEIGFNVSYVLDVLNTLRC-----DNVRVSMSDANASALI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              D DS         A YV+MP+R+
Sbjct: 350 ENADDDS---------AMYVVMPIRL 366


>gi|254447344|ref|ZP_05060810.1| DNA polymerase III, beta subunit [gamma proteobacterium HTCC5015]
 gi|198262687|gb|EDY86966.1| DNA polymerase III, beta subunit [gamma proteobacterium HTCC5015]
          Length = 366

 Score =  226 bits (577), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 131/385 (34%), Positives = 218/385 (56%), Gaps = 19/385 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+ + R  +L  L      +ERKNT+P   +VL++A  G +++ A+  EIE+       
Sbjct: 1   MKLHLSRESLLTPLQKVIGAVERKNTMPALGNVLIKAQGGEIQMTATDLEIELLAKSVLP 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           VD  G IT+ A  L DI + L DGA I+   + E  T   +S G S F L + P ++FP 
Sbjct: 61  VDQEGDITLPARKLLDICKNLPDGADITLQVDAERAT---LSSGRSRFKLSTLPAADFPQ 117

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
            +  + V  F L  S L+ ++++T FAMA +++RYYLNG+   ++   ++  AVATDGHR
Sbjct: 118 LEAVQGVTQFTLPQSTLRKVIDKTSFAMAQQDVRYYLNGLMLELDGSTVR--AVATDGHR 175

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LA+ E D    I     +I+PRK V E+ R+L  ++   +VSLS + I +++ +L  + +
Sbjct: 176 LALCETDAGLDIGDKKQVIIPRKGVQELSRLLDDEERDAEVSLSNNHIQVDLGNLRFTSK 235

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDG FP+YQ V+P + DK +  +  +L+ A+ R S++S+ + + V+L   +  L +  +
Sbjct: 236 LIDGRFPDYQRVMPANCDKVVSADKQDLKLALTRTSVLSNEKYKGVRLVADNGALTIQTN 295

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           NP+  +A E + V Y    M+I FN  Y+L++++N++     ++ V   L  +NSS  + 
Sbjct: 296 NPEQEEAEEQLEVQYQGENMEIGFNVNYMLDVLNNLT-----EELVTIALKDANSSCLVE 350

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
                    +  +  A YV+MPMR+
Sbjct: 351 ---------EVGEQTAKYVIMPMRL 366


>gi|271498580|ref|YP_003331605.1| DNA polymerase III subunit beta [Dickeya dadantii Ech586]
 gi|270342135|gb|ACZ74900.1| DNA polymerase III, beta subunit [Dickeya dadantii Ech586]
          Length = 366

 Score =  226 bits (576), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 131/386 (33%), Positives = 219/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK  VER  +L+ L      +  + T+P+  ++LLQ ++G L +  +  E+E+   +   
Sbjct: 1   MKFIVEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVSEGRLSLTGTDLEMEMVAHLALT 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A  L+DI R L DGA+IS   E   G  + +  G S F L + P ++FP
Sbjct: 61  QPHEPGATTVPARKLFDICRGLPDGAEISVTLE---GDRMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATLKRLIEATQFSMAHQDVRYYLNGMLFETGGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  +  V Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + 
Sbjct: 176 RLAVCAMP-VGQSLPSHSVIVPRKGVMELVRLLDGGDTPLQLQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L  +C  LRQA  R +I+S+ + + V+L L+ ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLEASCDLLRQAFSRAAILSNEKFRGVRLYLNQNQLRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ +  +EV       R+  ++S   +
Sbjct: 295 NNPEQEEAEEILDVEYGGTEMEIGFNVSYVLDVLNALKCEEV-------RMLLTDSVSSV 347

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +D  S+        A YV+MPMR+
Sbjct: 348 QLEDAASQ-------AAAYVVMPMRL 366


>gi|323493782|ref|ZP_08098900.1| DNA polymerase III subunit beta [Vibrio brasiliensis LMG 20546]
 gi|323311916|gb|EGA65062.1| DNA polymerase III subunit beta [Vibrio brasiliensis LMG 20546]
          Length = 366

 Score =  226 bits (575), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 124/386 (32%), Positives = 221/386 (57%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK ++ERS +L+ L      +  + T+P+  ++LL+  D +L + A+  E+E+   +   
Sbjct: 1   MKFSIERSHLLKPLQQVSGALGGRPTLPILGNLLLKVEDNVLSMTATDLEVELISRVTLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   GSITV +    DI R L D + I+F  +   G  V +  G S F L + P ++FP
Sbjct: 61  GEFEAGSITVPSRKFLDICRGLPDDSVITFVLD---GDRVQVRSGRSRFSLSTLPANDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +      L  + L+ LVE+T F+MA +++RYYLNG+ F I+   L+  +VATDGH
Sbjct: 118 NIEDWQSEVEVSLTQAELRGLVEKTQFSMANQDVRYYLNGMLFEIDGTTLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AV++V + A  A+   IIVPRK V E++++L + +  V + +  S +   + +   + 
Sbjct: 176 RMAVSQVQLGADFAQ-KQIIVPRKGVLELVKLLDAPEQPVVLQIGSSNVRAEVNNYVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P S  K L   C  LRQA  R +I+S+ + + V+++L+  ++ +T 
Sbjct: 235 KLVDGRFPDYRRVMPQSTTKTLEAGCDELRQAFSRAAILSNEKFRGVRVNLADTEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V +   P++I FN  Y+L++++ +       ++V   +  +N+S  I
Sbjct: 295 NNPEQEEAEEMLDVSFEGEPIEIGFNVSYVLDVLNTLRC-----EKVRVSMSDANASALI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              D DS         A YV+MP+R+
Sbjct: 350 ENADDDS---------AMYVVMPIRL 366


>gi|260774982|ref|ZP_05883882.1| DNA polymerase III beta subunit [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260609072|gb|EEX35231.1| DNA polymerase III beta subunit [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 366

 Score =  225 bits (574), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 121/386 (31%), Positives = 219/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK ++ER+ +L+ L      +  + T+P+  ++LL+  D +L + A+  E+E+   +   
Sbjct: 1   MKFSIERNHLLKPLQQVSGALGGRPTLPILGNLLLKVEDNMLSMTATDLEVELISRVALE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D   GS+TV +    DI R L D + I+F  E   G  V +  G S F L + P ++FP
Sbjct: 61  GDFEAGSVTVPSRKFLDICRGLPDDSVITFVLE---GDRVQVRSGRSRFSLSTLPANDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +      L    L+ L+E+T F+MA +++RYYLNG+ F I+   L+  +VATDGH
Sbjct: 118 NIEDWQSEVEVSLTQGELRGLIEKTQFSMANQDVRYYLNGMLFEIDGTTLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AV++V + A  A+   IIVPRK V E++++L + +  V + +  S +   + +   + 
Sbjct: 176 RMAVSQVQLGADFAQQ-QIIVPRKGVLELVKLLDAPEQPVTLQIGSSNVRAEVNNFVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P +  K L   C  LRQA  R +I+S+ + + V+++L+  ++ +T 
Sbjct: 235 KLVDGRFPDYRRVMPQTTTKTLEAECDELRQAFSRAAILSNEKFRGVRVNLADTEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V +   P++I FN  Y+L++++ +       ++V   +  +N+S  I
Sbjct: 295 NNPEQEEAEEMLDVSFEGDPIEIGFNVSYVLDVLNTLRC-----EKVRVSMSDANASAMI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              D D          A YV+MP+R+
Sbjct: 350 ENVDDDG---------AMYVVMPIRL 366


>gi|121587274|ref|ZP_01677047.1| DNA polymerase III, beta chain [Vibrio cholerae 2740-80]
 gi|261213262|ref|ZP_05927544.1| DNA polymerase III beta subunit [Vibrio sp. RC341]
 gi|121548520|gb|EAX58576.1| DNA polymerase III, beta chain [Vibrio cholerae 2740-80]
 gi|260837536|gb|EEX64239.1| DNA polymerase III beta subunit [Vibrio sp. RC341]
          Length = 366

 Score =  225 bits (574), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 123/386 (31%), Positives = 217/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ERS +++ L      +  + ++P+  ++LL+  D  L + A+  E+E+   +   
Sbjct: 1   MKFTIERSHLIKPLQQVSGTLGGRASLPILGNLLLKVEDNQLSMTATDLEVELISRVTLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   GSITV A    DI R L D A I+   E   G  + +  G S F L + P S+FP
Sbjct: 61  GEFEAGSITVPARKFLDICRGLPDSAVITVLLE---GDRIQVRSGRSRFSLATLPASDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +      L  + L+ L+E+T F+MA +++RYYLNG+ F I+   L+  +VATDGH
Sbjct: 118 NIEDWQSEVQVSLTQAELRGLIEKTQFSMANQDVRYYLNGMLFEIDGTTLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AVA+  + A  A+   IIVPRK V E++++L + +  V + +  S +   +     + 
Sbjct: 176 RMAVAQAQLGADFAQ-KQIIVPRKGVLELVKLLDAPEQPVVLQIGHSNLRAEVNHFVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P    K L+  C  LRQA  R +I+S+ + + V+++L+ +++ +T 
Sbjct: 235 KLVDGRFPDYRRVLPQHTSKTLQAGCEELRQAFSRAAILSNEKFRGVRVNLADNEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V +   P++I FN  Y+L++++ +       D V   +  +N+S  +
Sbjct: 295 NNPEQEEAEELLDVSFEGEPIEIGFNVSYILDVLNTLRC-----DNVRVSMSDANASALV 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              D DS         A YV+MP+R+
Sbjct: 350 ENVDDDS---------AMYVVMPIRL 366


>gi|332533699|ref|ZP_08409558.1| DNA polymerase III beta subunit [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332036863|gb|EGI73324.1| DNA polymerase III beta subunit [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 367

 Score =  225 bits (574), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 130/387 (33%), Positives = 219/387 (56%), Gaps = 22/387 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+IT+ R   L+ L      IERK+T+P+  +VLL   +G L +  +  EIE+   +   
Sbjct: 1   MQITISRQQFLKPLVQVSGAIERKHTLPILSNVLLVVENGQLSMTGTDLEIELVSGVFVG 60

Query: 61  VDVCGS-ITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESEF 118
            D+  + +T+ A  L DI + L DG+ I+   +E++L     ++ G S F L +    +F
Sbjct: 61  DDIADTKLTLPAKKLLDICKSLPDGSDITLSLQEHQL----LLTSGKSRFSLTTLSADDF 116

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P+ ++ +    F+L    L+ L+E THF+MA +++RYYLNG+ F ++  D+K   VATDG
Sbjct: 117 PNLEQWDGEVEFQLTRLELRKLLESTHFSMANQDVRYYLNGMSFEVDNTDIK--TVATDG 174

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA+A+  +   +     +I+PRK V EI+R++ + D  V +    + I +     + +
Sbjct: 175 HRLAIAQKQLTQSLNTQRQLIIPRKGVQEIMRLMVADDELVTIQFGANHIRIIDIEFTFT 234

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +L+DG FP+Y+ V+P   DK +  N   LR A  RVSI+S+ + + V+L+LS+  L +T
Sbjct: 235 SKLVDGRFPDYRRVLPRGGDKVITANREWLRNAFQRVSILSNEKFRGVRLNLSNGLLKIT 294

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
            +NP+  +A E + V Y    ++I FN  Y+L++++ + +     ++V+F L  SNSS  
Sbjct: 295 ANNPEQEQAEEVVEVSYEGADLEIGFNVSYVLDVLNTLKT-----EDVLFTLADSNSSAL 349

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           I G   +          A YV+MPMR+
Sbjct: 350 IEGAGDEE---------AMYVVMPMRL 367


>gi|307133246|ref|YP_003885262.1| DNA polymerase III, subunit beta [Dickeya dadantii 3937]
 gi|306530775|gb|ADN00706.1| DNA polymerase III, beta subunit [Dickeya dadantii 3937]
          Length = 366

 Score =  225 bits (574), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 131/386 (33%), Positives = 220/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK  VER  +L+ L      +  + T+P+  ++LLQ ++G L +  +  E+E+   +   
Sbjct: 1   MKFIVEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVSEGRLSLTGTDLEMEMVAHLALT 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A  L+DI R L DGA+IS   E   G  + +  G S F L + P ++FP
Sbjct: 61  QPHEPGATTVPARKLFDICRGLPDGAEISVTLE---GDRMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + LK L+E T F+MA +++RYYLNG+ F  + E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATLKRLIEATQFSMAHQDVRYYLNGMLFETSGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  +  V Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + 
Sbjct: 176 RLAVCSMP-VGQSLPSHSVIVPRKGVMELVRLLDGGDTPLQLQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L  +C  LRQA  R +I+S+ + + V+L L+ ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLEASCDLLRQAFSRAAILSNEKFRGVRLYLNQNQLRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ +  ++V       RL  ++S   +
Sbjct: 295 NNPEQEEAEEILDVEYGGTEMEIGFNVSYVLDVLNALKCEDV-------RLLLTDSVSSV 347

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +D  S+        A YV+MPMR+
Sbjct: 348 QIEDAASQ-------AAAYVVMPMRL 366


>gi|114319168|ref|YP_740851.1| DNA polymerase III, beta subunit [Alkalilimnicola ehrlichii MLHE-1]
 gi|114225562|gb|ABI55361.1| DNA polymerase III, beta subunit [Alkalilimnicola ehrlichii MLHE-1]
          Length = 366

 Score =  225 bits (573), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 129/385 (33%), Positives = 210/385 (54%), Gaps = 19/385 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+I ++R D+L+ L     ++ER+ T+PV  +V L+  DGL  + A+  E+E+  ++P  
Sbjct: 1   MRIDIQREDLLKPLQAIIGVVERRQTLPVLANVRLELGDGLARLTATDLEVELVASLPCQ 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V   G IT+ A  L DI R L D +QI    + E     ++  G S F L +    ++PS
Sbjct: 61  VTEGGDITLPARKLLDICRNLPDQSQIQLQVDGE---RASLRAGRSRFTLATLSADDYPS 117

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
            ++     +  L    L+ L+ERTHF+MA +++RYYLNG+   +     ++  VATDGHR
Sbjct: 118 IEDIGARETVRLPQGQLRKLIERTHFSMAVQDVRYYLNGLMVELEPAMARM--VATDGHR 175

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LA+AE  I   +     +IVPRK V E+LR+L   D    + L ++ I + +  +  + +
Sbjct: 176 LALAEQAIDTGVEAPRQVIVPRKGVQELLRLLDHSDEGADLELGDNHIRVKLGDVRFTSK 235

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDG FP+Y+ V+P + +    VN  +LR A+ RVSI+S+ + + V+  L    L +   
Sbjct: 236 LIDGRFPDYRRVVPEATETPATVNREDLRHALLRVSILSNEKYRGVRFLLDGGTLKVASH 295

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           NP+  +A E ++V Y   P+++ FN  Y+L+ +  +      D++V   L  S SS  I+
Sbjct: 296 NPEQEEAEEEVSVDYGGAPLEVGFNAGYVLDALGALD-----DEDVRLTLRDSASSGLIQ 350

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
           G D  +           YV+MPMR+
Sbjct: 351 GVDDQTSR---------YVVMPMRL 366


>gi|251787654|ref|YP_003002375.1| DNA polymerase III subunit beta [Dickeya zeae Ech1591]
 gi|247536275|gb|ACT04896.1| DNA polymerase III, beta subunit [Dickeya zeae Ech1591]
          Length = 366

 Score =  225 bits (573), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 130/386 (33%), Positives = 219/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK  VER  +L+ L      +  + T+P+  ++LLQ ++G L +  +  E+E+   +   
Sbjct: 1   MKFIVEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVSEGRLSLTGTDLEMEMVAHLALT 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A  L+DI R L DGA+I+   E   G  + +  G S F L + P ++FP
Sbjct: 61  QPHEPGATTVPARKLFDICRGLPDGAEITVTLE---GDRMLVRSGRSRFSLSTLPATDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATLKRLIEATQFSMAHQDVRYYLNGMLFETGGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  +  V Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + 
Sbjct: 176 RLAVCAMP-VGQSLPSHSVIVPRKGVMELVRLLDGGDTPLQLQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L  +C  LRQA  R +I+S+ + + V+L L+ ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLEASCDLLRQAFSRAAILSNEKFRGVRLYLNQNQLRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ +  +EV       R+  ++S   +
Sbjct: 295 NNPEQEEAEEILDVEYGGTEMEIGFNVSYVLDVLNALKCEEV-------RMLLTDSVSSV 347

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +D  S+        A YV+MPMR+
Sbjct: 348 QLEDAASQ-------AAAYVVMPMRL 366


>gi|268593489|ref|ZP_06127710.1| DNA polymerase III, beta subunit [Providencia rettgeri DSM 1131]
 gi|291310911|gb|EFE51364.1| DNA polymerase III, beta subunit [Providencia rettgeri DSM 1131]
          Length = 366

 Score =  225 bits (573), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 131/386 (33%), Positives = 219/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ER  +L+ L      +  + T+P+  ++LLQ  +G L++  +  E+E+   +  +
Sbjct: 1   MKFTIEREQLLKPLQQVSGPLGGRPTLPILGNLLLQVKEGTLQLTGTDLEMEMMANVALT 60

Query: 61  VD-VCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   G+ TV A   +DI R L +G++I     ++    + +  G S F L + P ++FP
Sbjct: 61  GEHEIGATTVPARKFFDIWRGLPEGSEIHVELNDD---RLLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  S+LK L+E T F+MA +++RYYLNG+ F    ED  L  V+TDGH
Sbjct: 118 NLDDWQSEVEFSLPQSILKRLIEATQFSMAHQDVRYYLNGMLFET--EDQMLRTVSTDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  +DI  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + 
Sbjct: 176 RLAVCAMDI-GQSLPSHSVIVPRKGVIELMRLLDGGDTPLQLQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L  S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLEARCDLLKQAFSRAAILSNEKFRGVRLYFSENQLRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ + S     + V   L  + SSV I
Sbjct: 295 NNPEQEEAEEIVDVSYQGTEMEIGFNVSYILDVLNALKS-----ENVQLLLTDAVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D DSK        A YV+MPMR+
Sbjct: 350 --EDADSK-------AAVYVVMPMRL 366


>gi|292490135|ref|YP_003533030.1| DNA polymerase III subunit beta [Erwinia amylovora CFBP1430]
 gi|292901139|ref|YP_003540508.1| DNA polymerase III subunit beta [Erwinia amylovora ATCC 49946]
 gi|291200987|emb|CBJ48126.1| DNA polymerase III, beta-subunit [Erwinia amylovora ATCC 49946]
 gi|291555577|emb|CBA24171.1| DNA polymerase III, beta-subunit [Erwinia amylovora CFBP1430]
 gi|312174328|emb|CBX82581.1| DNA polymerase III, beta-subunit [Erwinia amylovora ATCC BAA-2158]
          Length = 366

 Score =  225 bits (573), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 130/386 (33%), Positives = 220/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK TVER  +L+ L      +  + T+P+  ++LLQ  +G L +  +  E+E+   +  +
Sbjct: 1   MKFTVERERLLKPLQQVSSPLGGRPTLPILGNLLLQVTEGTLLLTGTDLEMEMVARVALA 60

Query: 61  VD-VCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D   G+ TV A   +DI R L +GA+I+   E E    + +  G S F L + P S+FP
Sbjct: 61  QDHQPGATTVPARKFFDICRGLPEGAEIAVILEGE---RMLVRSGRSRFSLSTLPASDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  +  V Q     S+IVPRK V E++R+L + DS ++V +  + I  ++     + 
Sbjct: 176 RLAVCSMP-VGQSLPSHSVIVPRKGVIELVRLLDAGDSLLQVQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLDAGCDLLKQAFARAAILSNEKFRGVRLHISENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    ++I FN  Y+L++++ +  + V       RL  ++S   +
Sbjct: 295 NNPEQEEAEEMLDVTYGGTDLEIGFNVSYVLDVLNALKCENV-------RLLLTDSVSSV 347

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +D  S+       +A YV+MPMR+
Sbjct: 348 QIEDAASQ-------SAAYVVMPMRL 366


>gi|269962692|ref|ZP_06177037.1| DNA polymerase III, beta chain [Vibrio harveyi 1DA3]
 gi|269832615|gb|EEZ86729.1| DNA polymerase III, beta chain [Vibrio harveyi 1DA3]
          Length = 366

 Score =  224 bits (572), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 122/386 (31%), Positives = 219/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ERS +++ L      +  + T+P+  ++L++  + +L + A+  E+E+   +   
Sbjct: 1   MKFTIERSHLIKPLQQVSGALGGRPTLPILGNLLIKVEENVLSMTATDLEVELVSKVALE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D   GSITV +    DI R L D + I+F  E   G  V +  G S F L + P ++FP
Sbjct: 61  GDFEAGSITVPSRKFLDICRGLPDDSIITFVLE---GDRVQVRSGRSRFSLATLPANDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +      L  S L+ L+E+T F+MA +++RYYLNG+ F I+   L+  +VATDGH
Sbjct: 118 NIEDWQSEVEVSLTQSDLRTLIEKTQFSMANQDVRYYLNGMLFEIDGTTLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AV++  + A  A+   IIVPRK V E+++++ + +  V + +  S +   + +   + 
Sbjct: 176 RMAVSQTQLGADFAQ-KQIIVPRKGVQELVKLMDAPEQPVVLQIGSSNVRAEVNNFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P S  K L  +C  LRQA  R +I+S+ + + V+++L+  ++ +T 
Sbjct: 235 KLVDGRFPDYRRVMPQSTTKTLEASCDELRQAFSRAAILSNEKFRGVRVNLAGSEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V +    ++I FN  Y+L++++ +       D V   +  +N+S  I
Sbjct: 295 NNPEQEEAEEMLDVTFEGDAIEIGFNVSYVLDVLNTLRC-----DNVRVSMSDANASALI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              D DS         A YV+MP+R+
Sbjct: 350 ENADDDS---------AMYVVMPIRL 366


>gi|311696594|gb|ADP99467.1| DNA polymerase III, beta chain [marine bacterium HP15]
          Length = 367

 Score =  224 bits (572), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 126/386 (32%), Positives = 218/386 (56%), Gaps = 20/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAI-PA 59
           MK+T+ R  +L  L     ++E+K T+PV  +VLL A D  L +  +  E+E+   + P 
Sbjct: 1   MKLTISRESLLTPLQSIAGVVEKKQTMPVLSNVLLVAEDNTLTLTGTNMEVELVARVTPV 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            VD  G ITV A  L DI R L D A +    E   G  +++  G S+F L + P   FP
Sbjct: 61  HVDQPGRITVPARKLSDISRALGDEAPMELSLE---GDRLHLRCGASHFTLSTLPAEHFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++E+  +  EL    L  +++ T FAMA +++RYYLNG+   ++++ ++   VATDGH
Sbjct: 118 NVEDEDESFRLELPQKELGRMLDATAFAMAQQDVRYYLNGLLLEVDKDHVR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA+A +++     ++  +IVPRK V E+ R+L   ++ V + + ++ +   + S + + 
Sbjct: 176 RLAMAHLELATNCPELRQVIVPRKGVLELARLLDDVETPVTLVIGDNHLRATVGSYTFTS 235

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +LI+G+FP+Y  VIP   DK +  +   L+  + R  I+S   I+ V+L+L+S++L +  
Sbjct: 236 KLIEGKFPDYNRVIPRGGDKIVLADRATLKNTLQRAGILSHENIRGVRLNLASNELQVFA 295

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NPD  +A +++ V Y    + I FN  YL+++++ +      +D+V   L + NSS  I
Sbjct: 296 NNPDQEQAEDALPVDYQGESLQIGFNVGYLVDVMNALD-----EDQVKITLSNPNSSALI 350

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             ++       DN+    YV+MPMR+
Sbjct: 351 EAQN-------DNR--CLYVVMPMRL 367


>gi|326793324|ref|YP_004311144.1| DNA polymerase III subunit beta [Marinomonas mediterranea MMB-1]
 gi|326544088|gb|ADZ89308.1| DNA polymerase III, beta subunit [Marinomonas mediterranea MMB-1]
          Length = 365

 Score =  224 bits (571), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 142/389 (36%), Positives = 221/389 (56%), Gaps = 28/389 (7%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK +V R  +L+ L     ++ERK T+PV  +VL++  D +L +  S  E+E+ G +P  
Sbjct: 1   MKFSVVRETLLKPLQLVAGVVERKQTMPVLANVLVEVKDQVLTLTGSDLEVELVGQVP-- 58

Query: 61  VDVC--GSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEF 118
           +D C  G ITV A  L DI + L D A I F  + +   +  I  G S F L + P  EF
Sbjct: 59  LDDCQEGRITVPARKLVDICKSLPDSAVIEFSLDEQ---KAIIRSGRSRFSLSTLPADEF 115

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P+ ++ +   +  +A S ++ L++RT FAMA +++RYYLNG+ F +   D +L  VATDG
Sbjct: 116 PNIQDMQGDLTVNVAQSSVRRLIDRTGFAMANQDVRYYLNGMLFEV--ADGQLRVVATDG 173

Query: 179 HRLAVAEVDIVAQIAK-MPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           HRLA A  D  AQ++  +  +IVPRK V E+ R+LS  D  V++ +  + +   I+  + 
Sbjct: 174 HRLATAIED--AQVSGDLTQVIVPRKGVLELNRLLSDTDELVELKIGSNHVRATIDDYTF 231

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +L+DG+FP+Y  VIP +N+K +  +   LRQ   R SI+S+ + + V+L LS+  L +
Sbjct: 232 TSKLVDGKFPDYHRVIPRNNEKMVIADRQELRQVFLRASILSNEKYRGVRLILSNGMLQV 291

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVD-DEVVFRLDSSNSS 356
             +NP+  +A ES+ V Y    M++ FN  YLL+++       VVD  EV   ++ SNSS
Sbjct: 292 FANNPEQEEAEESVLVQYQGDGMEVGFNVGYLLDVLG------VVDAQEVRIAMNDSNSS 345

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             I      +         A YV+MPMR+
Sbjct: 346 ALIEEAQSHA---------AQYVVMPMRL 365


>gi|157368282|ref|YP_001476271.1| DNA polymerase III subunit beta [Serratia proteamaculans 568]
 gi|157320046|gb|ABV39143.1| DNA polymerase III, beta subunit [Serratia proteamaculans 568]
          Length = 366

 Score =  224 bits (571), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 130/386 (33%), Positives = 220/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  VER  +L+ L      +  + T+P+  ++LLQ  +G L +  +  E+E+   +  S
Sbjct: 1   MKFIVEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVTEGCLLLTGTDLEMEMVARVALS 60

Query: 61  -VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A  L+DI R L +GA+I+   E E    + +  G S F L + P  +FP
Sbjct: 61  QPHEAGATTVPARKLFDICRGLPEGAEITVTLEGE---RMLVRSGRSRFSLSTLPAVDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFSLPQATLKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q+    S+IVPRK V E++R+L   D+ +++ +  + I  ++     + 
Sbjct: 176 RLAVCSMPIGQQLPSH-SVIVPRKGVMELVRLLDGGDTLLQLQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLEAGCDLLKQAFARAAILSNEKFRGVRLYVSQNQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y+   M+I FN  Y+L++++ +  ++V       RL  ++S   +
Sbjct: 295 NNPEQEEAEEILDVSYDGTEMEIGFNVSYVLDVLNALKCEDV-------RLLLTDSVSSV 347

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +D  SK       +A YV+MPMR+
Sbjct: 348 QIEDGASK-------SAAYVVMPMRL 366


>gi|110832863|ref|YP_691722.1| DNA polymerase III subunit beta [Alcanivorax borkumensis SK2]
 gi|110645974|emb|CAL15450.1| DNA polymerase III, beta subunit [Alcanivorax borkumensis SK2]
          Length = 366

 Score =  224 bits (571), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 130/388 (33%), Positives = 221/388 (56%), Gaps = 25/388 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK ++ R  +L+ L     ++E++ T+PV  +VLL+  DG L +  +  E+E+   +P  
Sbjct: 1   MKFSINREQLLKPLQQVAAVVEKRQTLPVLSNVLLEVGDGQLSMTGTDLELELVARLPLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            ++  G  TV A  L DI + L   A I F  + E    + +  G S F L + P SEFP
Sbjct: 61  GELEPGETTVPARKLVDIGKSLPAEADIRFEVDGE---RMLVRSGRSRFTLSTLPASEFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + +E+    S E+   VL+ L++RT F+MA +++RYYLNG+ F +    L+  AVATDGH
Sbjct: 118 NLEEDAAGSSLEIKPDVLRGLIDRTAFSMAQQDVRYYLNGMLFELKSGRLR--AVATDGH 175

Query: 180 RLAV--AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           RLA+  AE+D+  + A   S+I+PRK V E+ RIL       ++++  + + + + +++ 
Sbjct: 176 RLALCDAELDVPVEEA---SVILPRKGVMELSRILGDSGEVARLTIGRNHVRIVVGAITF 232

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +L+DG+FP Y  VIP    +++  +   LRQA+ RV+I+S+ + + V++ LS   L +
Sbjct: 233 TSKLVDGKFPEYDRVIPKEGSRKVVADRETLRQALARVAILSNEKYRGVRVQLSEGSLRI 292

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
             +NP+  +A E ++V +N  P++I FN  YLL++++ +        +    +  SNSS 
Sbjct: 293 VANNPEQEEAEEEVSVDFNGSPLEIGFNVSYLLDVLNTMGG-----TQAELEMGDSNSSA 347

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            +   D +SK        A YV+MPMR+
Sbjct: 348 LV--FDPESK-------AAVYVVMPMRL 366


>gi|119471659|ref|ZP_01614044.1| DNA polymerase III, beta-subunit; processivity clamp of DNA
           polymerase III [Alteromonadales bacterium TW-7]
 gi|119445438|gb|EAW26725.1| DNA polymerase III, beta-subunit; processivity clamp of DNA
           polymerase III [Alteromonadales bacterium TW-7]
          Length = 367

 Score =  224 bits (571), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 129/386 (33%), Positives = 218/386 (56%), Gaps = 20/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+IT+ R   L+ L      IERK+T+P+  +VLL   +G L +  +  EIE+   +   
Sbjct: 1   MQITISRQQFLKPLVQVSGAIERKHTLPILSNVLLVVENGQLSMTGTDLEIELVSGVFVG 60

Query: 61  VDVCGS-ITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D+  + +T+ A  L DI + L +G+ I+   ++    ++ ++ G S F L +   ++FP
Sbjct: 61  DDIADTKLTLPAKKLLDICKSLPEGSDITLSLQDH---QLLLTSGKSRFSLTTLSAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + +E +    F+L    L+ L+E THF+MA +++RYYLNG+ F ++  D+K   VATDGH
Sbjct: 118 NLEEWDGEVEFQLTRLELRKLLESTHFSMANQDVRYYLNGMSFEVDNSDIK--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA+A+  +   +     +I+PRK V EI+R++ + D  V +    + I +     + + 
Sbjct: 176 RLAIAQKKLTQSLNTQRQLIIPRKGVQEIMRLMVADDELVTIQFGANHIRIIDIEFTFTS 235

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P   DK +  N   LR A  RVSI+S+ + + V+L+LS+  L +T 
Sbjct: 236 KLVDGRFPDYRRVLPRGGDKTIIANREWLRNAFQRVSILSNEKFRGVRLNLSNGLLKITA 295

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E + V Y    ++I FN  Y+L++++ + +     ++V F L  SNSS  I
Sbjct: 296 NNPEQEQAEEVVEVNYQGDELEIGFNVSYVLDVLNTLKT-----EDVQFTLADSNSSALI 350

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
            G   D          A YV+MPMR+
Sbjct: 351 EGAGDDE---------AMYVVMPMRL 367


>gi|229524914|ref|ZP_04414319.1| DNA polymerase III beta subunit [Vibrio cholerae bv. albensis
           VL426]
 gi|229338495|gb|EEO03512.1| DNA polymerase III beta subunit [Vibrio cholerae bv. albensis
           VL426]
          Length = 366

 Score =  224 bits (571), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 122/386 (31%), Positives = 217/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ERS +++ L      +  + ++P+  ++LL+  +  L + A+  E+E+   +   
Sbjct: 1   MKFTIERSHLIKPLQQVSGTLGGRASLPILGNLLLKVEENQLSMTATDLEVELISRVTLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   GSITV A    DI R L D A I+   E   G  + +  G S F L + P S+FP
Sbjct: 61  GEFEAGSITVPARKFLDICRGLPDSAVITVLLE---GDRIQVRSGRSRFSLATLPASDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +      L  + L+ L+E+T F+MA +++RYYLNG+ F I+   L+  +VATDGH
Sbjct: 118 NIEDWQSEVQVSLTQAELRGLIEKTQFSMANQDVRYYLNGMLFEIDGTTLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AVA+  + A  A+   IIVPRK V E++++L + +  V + +  S +   +     + 
Sbjct: 176 RMAVAQAQLGADFAQ-KQIIVPRKGVLELVKLLDAPEQPVVLQIGHSNLRAEVNHFVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P    K L+  C  LRQA  R +I+S+ + + V+++L+ + + +T 
Sbjct: 235 KLVDGRFPDYRRVLPQHTSKTLQAGCEELRQAFSRAAILSNEKFRGVRVNLADNGMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V +   P++I FN  Y+L++++ +       D+V   +  +N+S  +
Sbjct: 295 NNPEQEEAEELLDVSFEGDPIEIGFNVSYVLDVLNTLRC-----DQVRVSMSDANASALV 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              D DS         A YV+MP+R+
Sbjct: 350 ENVDDDS---------AMYVVMPIRL 366


>gi|21229480|ref|NP_635397.1| DNA polymerase III subunit beta [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66766354|ref|YP_241116.1| DNA polymerase III subunit beta [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|188989398|ref|YP_001901408.1| DNA polymerase III subunit beta [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21110940|gb|AAM39321.1| DNA polymerase III beta chain [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66571686|gb|AAY47096.1| DNA polymerase III beta chain [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167731158|emb|CAP49330.1| DNA polymerase III beta chain [Xanthomonas campestris pv.
           campestris]
          Length = 366

 Score =  224 bits (571), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 128/385 (33%), Positives = 220/385 (57%), Gaps = 19/385 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ T++R   L+ L     ++ER+ T+PV  ++L+Q N+G L +  +  E+E+       
Sbjct: 1   MRFTLQREAFLKPLAQVVNVVERRQTLPVLANLLVQVNNGQLSLTGTDLEVEMISRTMVE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               G  T+ A  L+DI+R L DG++++    ++ G +V +  G S F L + P ++FPS
Sbjct: 61  DAQDGETTIPARKLFDILRALPDGSRVTV---SQTGDKVTVQAGRSRFTLATLPANDFPS 117

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
             E E      +  + LK L+ERT FAMA +++RYYLNG+ F + +  L+ C VATDGHR
Sbjct: 118 VDEVEATERVAVPEAGLKELMERTAFAMAQQDVRYYLNGLLFDLRDGLLR-C-VATDGHR 175

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LA+ E ++    +    IIVPRK V E+LR+L + D  V++ L  S I +    ++ + +
Sbjct: 176 LALCETELEKSGSAKRQIIVPRKGVTELLRLLEAADRDVELELGRSHIRVKRGDVTFTSK 235

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDG FP+Y+ VIP   D+E++V+   LR ++ R +I+S+ + + V++ +S  +L ++  
Sbjct: 236 LIDGRFPDYEAVIPIGADREVKVDREALRASLQRAAILSNEKYRGVRVEVSPGQLKISAH 295

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           NP+  +A E +        + I FN  YLL+ +  +      D+ VV +L  +NSS  +R
Sbjct: 296 NPEQEEAQEEIEADTKVDDLAIGFNVNYLLDALSALR-----DEHVVIQLRDANSSALVR 350

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
             +  S+ ++       +V+MP+R+
Sbjct: 351 --EASSEKSR-------HVVMPLRL 366


>gi|323496928|ref|ZP_08101956.1| DNA polymerase III subunit beta [Vibrio sinaloensis DSM 21326]
 gi|323318002|gb|EGA70985.1| DNA polymerase III subunit beta [Vibrio sinaloensis DSM 21326]
          Length = 366

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 120/386 (31%), Positives = 221/386 (57%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK ++ERS +L+ L      +  + T+P+  ++LL+  D +L + A+  E+E+   +   
Sbjct: 1   MKFSIERSHLLKPLQQVSGALGGRPTLPILGNLLLKVEDNVLSMTATDLEVELISRVTLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   GS+TV +    DI R L D + I+F  E   G  V +  G S F L + P S+FP
Sbjct: 61  GEFEAGSVTVPSRKFLDICRGLPDDSVITFVLE---GDRVQVRSGRSRFSLSTLPASDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +      L+ + L+ L+E+T F+MA +++RYYLNG+ F I+   L+  +VATDGH
Sbjct: 118 NIEDWQSEVEISLSQAELRGLIEKTQFSMANQDVRYYLNGMLFEIDGTTLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AV++  + A  A+   IIVPRK V E+++++ + +  V + +  S +   + +   + 
Sbjct: 176 RMAVSQTQLGADFAQQ-QIIVPRKGVLELVKLMDAPEQPVTLQIGSSNLRAEVNNFVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P +  K L   C  LR A  R +I+S+ + + V+++L+  ++ +T 
Sbjct: 235 KLVDGRFPDYRRVMPQNTTKTLETGCDELRSAFSRAAILSNEKFRGVRVNLADTEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V ++  P++I FN  Y+L++++ +       ++V   +  +N+S  I
Sbjct: 295 NNPEQEEAEEMLDVSFDGEPIEIGFNVSYVLDVLNTLRC-----EKVRVSMSDANASALI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              D DS         A YV+MP+R+
Sbjct: 350 ENADDDS---------AMYVVMPIRL 366


>gi|262392782|ref|YP_003284636.1| DNA polymerase III subunit beta [Vibrio sp. Ex25]
 gi|262336376|gb|ACY50171.1| DNA polymerase III beta subunit [Vibrio sp. Ex25]
          Length = 366

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 121/386 (31%), Positives = 222/386 (57%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ERS +++ L      +  + T+P+  ++LL+  + +L + A+  E+E+   +   
Sbjct: 1   MKFTIERSHLIKPLQQVSGALGGRPTLPILGNLLLKVEENVLSMTATDLEVELVSKVTLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D   GSITV +    DI R L D A I+F  E   G  V +  G S F L + P ++FP
Sbjct: 61  GDFEAGSITVPSRKFLDICRGLPDDAIITFVLE---GDRVQVRSGRSRFSLATLPANDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +      L+ + L+ L+++T F+MA +++RYYLNG+ F I+   L+  +VATDGH
Sbjct: 118 NIEDWQSEVEVSLSQADLRTLIDKTQFSMANQDVRYYLNGMLFEIDGTTLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AV++  + A  A+   IIVPRK V E+++++ + +  V + +  S +   + + + + 
Sbjct: 176 RMAVSQTQLGADFAQ-KQIIVPRKGVQELVKLMDAPEQPVVLQIGSSNVRAEVNNFTFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P S +K L  +C  LRQA  R +I+S+ + + V+++L+  ++ +T 
Sbjct: 235 KLVDGRFPDYRRVLPQSTNKTLIASCDELRQAFSRAAILSNEKFRGVRVNLADTEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V +    ++I FN  Y+L++++ +       + V   +  +N+S  I
Sbjct: 295 NNPEQEEAEEMLDVTFEGDAIEIGFNVSYVLDVLNTLRC-----ENVRVSMSDANASALI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              D DS         A YV+MP+R+
Sbjct: 350 ENADDDS---------AMYVVMPIRL 366


>gi|149375635|ref|ZP_01893404.1| DNA polymerase III, beta subunit [Marinobacter algicola DG893]
 gi|149360037|gb|EDM48492.1| DNA polymerase III, beta subunit [Marinobacter algicola DG893]
          Length = 371

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 128/386 (33%), Positives = 214/386 (55%), Gaps = 20/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAI-PA 59
           MK+T+ R  +L  L     ++ERK T+PV  +VLL A D  L +  +  E+E+ G + P 
Sbjct: 5   MKLTISRESLLTPLQSIAGVVERKQTMPVLSNVLLVAEDNTLTLTGTNMEVELVGRVSPV 64

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            VD  G ITV A  L DI R L D A I    E   G  +++  G S+F L + P   FP
Sbjct: 65  HVDQPGRITVPARKLSDICRALGDEAPIELALE---GDRLHLRCGASHFTLSTLPAEHFP 121

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + +++   +  EL    L  + + T FAMA +++RYYLNG+   ++++ ++   VATDGH
Sbjct: 122 NVEDDAESFGLELPQKELSRMFDATAFAMAQQDVRYYLNGLLLEVDKDHVR--TVATDGH 179

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA+A  D+     +   +IVPRK V E+ R+L   ++ V + + ++ +   + S + + 
Sbjct: 180 RLAMAHFDLPTGCPEPRQVIVPRKGVLELARLLDDVETPVTLVIGDNHLRATVGSYTFTS 239

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +LI+G+FP+Y  VIP   DK +  +   L+  + R  I+S   I+ V+L+L+ ++L +  
Sbjct: 240 KLIEGKFPDYNRVIPRGGDKVVLADRATLKNTLQRAGILSHENIRGVRLNLAPNELQVFA 299

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NPD  +A +++ V Y    + I FN  YL+++++ +      +D+V   L + NSS  I
Sbjct: 300 NNPDQEQAEDALPVEYQGESLQIGFNVGYLVDVMNALD-----EDQVKITLANPNSSALI 354

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             ++       DN+    YV+MPMR+
Sbjct: 355 EAEN-------DNR--CLYVVMPMRL 371


>gi|322830735|ref|YP_004210762.1| DNA polymerase III, subunit beta [Rahnella sp. Y9602]
 gi|321165936|gb|ADW71635.1| DNA polymerase III, beta subunit [Rahnella sp. Y9602]
          Length = 366

 Score =  224 bits (570), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 132/386 (34%), Positives = 219/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  VER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +  S
Sbjct: 1   MKFIVEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVTDGALSLTGTDLEMEMVAKVALS 60

Query: 61  -VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+IS   +   G  + +  G S F L + P ++FP
Sbjct: 61  QPHEAGATTVPARKFFDICRGLPEGAEISVALD---GDRMLVKSGRSRFSLSTLPATDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATLKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E++R+L   D+++++ +  + I  ++     + 
Sbjct: 176 RLAVCSMPI-GQSLPSHSVIVPRKGVMELVRLLDGGDTTLQLQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L+  C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLQAGCDLLKQAFARAAILSNEKFRGVRLYVSHNQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ +       ++V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVGYEGTEMEIGFNVSYVLDVLNALKC-----EDVNLLLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       +A YV+MPMR+
Sbjct: 350 --EDAASQ-------SAAYVVMPMRL 366


>gi|269965277|ref|ZP_06179398.1| DNA polymerase III, beta chain [Vibrio alginolyticus 40B]
 gi|269830078|gb|EEZ84306.1| DNA polymerase III, beta chain [Vibrio alginolyticus 40B]
          Length = 366

 Score =  224 bits (570), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 121/386 (31%), Positives = 222/386 (57%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ERS +++ L      +  + T+P+  ++LL+  + +L + A+  E+E+   +   
Sbjct: 1   MKFTIERSHLIKPLQQVSGALGGRPTLPILGNLLLKVEENVLSMTATDLEVELVSKVTLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D   GSITV +    DI R L D A I+F  E   G  V +  G S F L + P ++FP
Sbjct: 61  GDFEAGSITVPSRKFLDICRGLPDDAIITFVLE---GDRVQVRSGRSRFSLATLPANDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +      L+ + L+ L+++T F+MA +++RYYLNG+ F I+   L+  +VATDGH
Sbjct: 118 NIEDWQSEVEVSLSQADLRTLIDKTQFSMANQDVRYYLNGMLFEIDGTTLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AV++  + A  A+   IIVPRK V E+++++ + +  V + +  S +   + + + + 
Sbjct: 176 RMAVSQTQLGADFAQ-KQIIVPRKGVQELVKLMDAPEQPVVLQIGSSNVRAEVNNFTFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P S +K L  +C  LRQA  R +I+S+ + + V+++L+  ++ +T 
Sbjct: 235 KLVDGRFPDYRRVLPQSTNKTLIASCDELRQAFSRAAILSNEKFRGVRVNLADTEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V +    ++I FN  Y+L++++ +       + V   +  +N+S  I
Sbjct: 295 NNPEQEEAEEMLDVSFEGDAIEIGFNVSYVLDVLNTLRC-----ENVRVSMSDANASALI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              D DS         A YV+MP+R+
Sbjct: 350 ENADDDS---------AMYVVMPIRL 366


>gi|254428026|ref|ZP_05041733.1| DNA polymerase III, beta subunit [Alcanivorax sp. DG881]
 gi|196194195|gb|EDX89154.1| DNA polymerase III, beta subunit [Alcanivorax sp. DG881]
          Length = 366

 Score =  224 bits (570), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 126/386 (32%), Positives = 219/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK ++ R  +L+ L     ++E++ T+PV  +VLL+  DG L +  +  E+E+   +P  
Sbjct: 1   MKFSINREQLLKPLQQVAAVVEKRQTLPVLSNVLLEVGDGQLSMTGTDLELELVARLPLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   G  TV A  L DI + L   A I F  + E    + +  G S F L + P SEFP
Sbjct: 61  GEQEPGETTVPARKLVDIAKSLPAEADIRFEVDGE---RMLVRSGRSRFTLSTLPASEFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + +E+      E+   VL+ L++RT F+MA +++RYYLNG+ F +    L+  AVATDGH
Sbjct: 118 NLEEDAAGSRLEMKPDVLRGLIDRTAFSMAQQDVRYYLNGMLFELKPGRLR--AVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA+ + ++ A + +  S+I+PRK V E+ RIL     + ++++  + + + + +++ + 
Sbjct: 176 RLALCDAELDAPVEEA-SVILPRKGVMELSRILGDSGEAARLTIGRNHVRIVVGAITFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG+FP Y  VIP    +++  +   LRQA+ RV+I+S+ + + V++ LS   L +  
Sbjct: 235 KLVDGKFPEYDRVIPKEGSRKVVADRETLRQALARVAILSNEKYRGVRVQLSEGSLRIVA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V +N  P++I FN  YLL++++ +        +    +  SNSS  +
Sbjct: 295 NNPEQEEAEEEVSVDFNGSPLEIGFNVSYLLDVLNTMGG-----TQAELEMGDSNSSALV 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              D +SK        A YV+MPMR+
Sbjct: 350 --FDPESK-------AAVYVVMPMRL 366


>gi|153802490|ref|ZP_01957076.1| DNA polymerase III, beta chain [Vibrio cholerae MZO-3]
 gi|229530201|ref|ZP_04419590.1| DNA polymerase III beta subunit [Vibrio cholerae 12129(1)]
 gi|262402081|ref|ZP_06078645.1| DNA polymerase III beta subunit [Vibrio sp. RC586]
 gi|124121960|gb|EAY40703.1| DNA polymerase III, beta chain [Vibrio cholerae MZO-3]
 gi|229332334|gb|EEN97821.1| DNA polymerase III beta subunit [Vibrio cholerae 12129(1)]
 gi|262351727|gb|EEZ00859.1| DNA polymerase III beta subunit [Vibrio sp. RC586]
 gi|327482926|gb|AEA77333.1| DNA polymerase III beta subunit [Vibrio cholerae LMA3894-4]
          Length = 366

 Score =  223 bits (569), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 122/386 (31%), Positives = 217/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ERS +++ L      +  + ++P+  ++LL+  +  L + A+  E+E+   +   
Sbjct: 1   MKFTIERSHLIKPLQQVSGTLGGRASLPILGNLLLKVEENQLSMTATDLEVELISRVTLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   GSITV A    DI R L D A I+   E   G  + +  G S F L + P S+FP
Sbjct: 61  GEFEAGSITVPARKFLDICRGLPDSAVITVLLE---GDRIQVRSGRSRFSLATLPASDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +      L  + L+ L+E+T F+MA +++RYYLNG+ F I+   L+  +VATDGH
Sbjct: 118 NIEDWQSEVQVSLTQAELRGLIEKTQFSMANQDVRYYLNGMLFEIDGTTLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AVA+  + A  A+   IIVPRK V E++++L + +  V + +  S +   +     + 
Sbjct: 176 RMAVAQAQLGADFAQ-KQIIVPRKGVLELVKLLDAPEQPVVLQIGHSNLRAEVNHFVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P    K L+  C  LRQA  R +I+S+ + + V+++L+ +++ +T 
Sbjct: 235 KLVDGRFPDYRRVLPQHTSKTLQAGCEELRQAFSRAAILSNEKFRGVRVNLADNEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V +   P++I FN  Y+L++++ +       D V   +  +N+S  +
Sbjct: 295 NNPEQEEAEELLDVSFEGEPIEIGFNVSYILDVLNTLRC-----DNVRVSMSDANASALV 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              D DS         A YV+MP+R+
Sbjct: 350 ENVDDDS---------AMYVVMPIRL 366


>gi|259910294|ref|YP_002650650.1| DNA polymerase III subunit beta [Erwinia pyrifoliae Ep1/96]
 gi|224965916|emb|CAX57449.1| DNA polymerase III subunit beta [Erwinia pyrifoliae Ep1/96]
 gi|283480418|emb|CAY76334.1| DNA polymerase III, beta-subunit [Erwinia pyrifoliae DSM 12163]
 gi|310765873|gb|ADP10823.1| DNA polymerase III subunit beta [Erwinia sp. Ejp617]
          Length = 366

 Score =  223 bits (569), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 129/386 (33%), Positives = 219/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK TVER  +L+ L      +  + T+P+  ++LLQ  +G L +  +  E+E+   +  +
Sbjct: 1   MKFTVERERLLKPLQQVSSPLGGRPTLPILGNLLLQVTEGTLLLTGTDLEMEMVARVALT 60

Query: 61  VD-VCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D   G+ TV A   +DI R L +GA+I+   E E    + +  G S F L + P S+FP
Sbjct: 61  HDHQPGATTVPARKFFDICRGLPEGAEIAVILEGE---RMLVRSGRSRFSLSTLPASDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  +  V Q     S+IVPRK V E++R+L   DS +++ +  + I  ++     + 
Sbjct: 176 RLAVCSMP-VGQSLPSHSVIVPRKGVIELVRLLDGGDSLLQIQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLDAGCDLLKQAFARAAILSNEKFRGVRLHISENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    ++I FN  Y+L++++ +  + V       RL  ++S   +
Sbjct: 295 NNPEQEEAEEMLDVTYGGTDLEIGFNVSYVLDVLNALKCENV-------RLLLTDSVSSV 347

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +D  S+       +A YV+MPMR+
Sbjct: 348 QIEDAASQ-------SAAYVVMPMRL 366


>gi|156936081|ref|YP_001439997.1| DNA polymerase III subunit beta [Cronobacter sakazakii ATCC
           BAA-894]
 gi|156534335|gb|ABU79161.1| hypothetical protein ESA_03975 [Cronobacter sakazakii ATCC BAA-894]
          Length = 366

 Score =  223 bits (569), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 131/386 (33%), Positives = 218/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +   
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGALSLTGTDLEMEMVARVALV 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   +   G  + +S G S F L + P ++FP
Sbjct: 61  QPHEPGATTVPARKFFDICRGLPEGAEIAVQLD---GDRMRVSSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F    EDL+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEDLR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  +  V Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + 
Sbjct: 176 RLAVCAMP-VGQPLPNHSVIVPRKGVLELMRMLDGGDAPLRIQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLEAGCDILKQAFARAAILSNEKFRGVRLYVSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVTYAGAEMEIGFNVSYVLDVLNALKC-----ENVRILLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
               +D+ ++     +A YV+MPMR+
Sbjct: 350 ----EDAASS-----SAAYVVMPMRL 366


>gi|260595831|ref|YP_003208402.1| DNA polymerase III subunit beta [Cronobacter turicensis z3032]
 gi|260215008|emb|CBA26670.1| DNA polymerase III subunit beta [Cronobacter turicensis z3032]
          Length = 366

 Score =  223 bits (569), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 131/386 (33%), Positives = 218/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +   
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGALSLTGTDLEMEMVARVALV 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   +   G  + +S G S F L + P ++FP
Sbjct: 61  QPHEPGATTVPARKFFDICRGLPEGAEIAVQLD---GDRMRVSSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F    EDL+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEDLR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  +  V Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + 
Sbjct: 176 RLAVCSMP-VGQPLPNHSVIVPRKGVLELMRMLDGGDAPLRIQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLEAGCDILKQAFARAAILSNEKFRGVRLYVSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVTYPGTEMEIGFNVSYVLDVLNALKC-----ENVRILLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
               +D+ ++     +A YV+MPMR+
Sbjct: 350 ----EDAASS-----SAAYVVMPMRL 366


>gi|28896786|ref|NP_796391.1| DNA polymerase III subunit beta [Vibrio parahaemolyticus RIMD
           2210633]
 gi|260363485|ref|ZP_05776318.1| DNA polymerase III, beta subunit [Vibrio parahaemolyticus K5030]
 gi|260876544|ref|ZP_05888899.1| DNA polymerase III, beta subunit [Vibrio parahaemolyticus AN-5034]
 gi|260901415|ref|ZP_05909810.1| DNA polymerase III, beta subunit [Vibrio parahaemolyticus AQ4037]
 gi|28804994|dbj|BAC58275.1| DNA polymerase III, beta chain [Vibrio parahaemolyticus RIMD
           2210633]
 gi|308090394|gb|EFO40089.1| DNA polymerase III, beta subunit [Vibrio parahaemolyticus AN-5034]
 gi|308107195|gb|EFO44735.1| DNA polymerase III, beta subunit [Vibrio parahaemolyticus AQ4037]
 gi|308113560|gb|EFO51100.1| DNA polymerase III, beta subunit [Vibrio parahaemolyticus K5030]
 gi|328471239|gb|EGF42141.1| DNA polymerase III subunit beta [Vibrio parahaemolyticus 10329]
          Length = 366

 Score =  223 bits (569), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 120/386 (31%), Positives = 222/386 (57%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ERS +++ L      +  + T+P+  ++L++  + +L + A+  E+E+   +   
Sbjct: 1   MKFTIERSHLIKPLQQVSGALGGRPTLPILGNLLIKVEENVLSMTATDLEVELVSKVTLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D   GSITV +    DI R L D A I+F  E   G  V +  G S F L + P ++FP
Sbjct: 61  GDFEAGSITVPSRKFLDICRGLPDDAIITFVLE---GDRVQVRSGRSRFSLATLPANDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +      L+ + L+ L+++T F+MA +++RYYLNG+ F I+   L+  +VATDGH
Sbjct: 118 NIEDWQSEVEVSLSQADLRTLIDKTQFSMANQDVRYYLNGMLFEIDGTTLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AV++  + A  A+   IIVPRK V E+++++ + +  V + +  S +   + +   + 
Sbjct: 176 RMAVSQTQLGADFAQ-KQIIVPRKGVQELVKLMDAPEQPVVLQIGSSNVRAEVNNFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P   +K L  +C  LRQA  R +I+S+ + + V+++L+  ++ +T 
Sbjct: 235 KLVDGRFPDYRRVLPQHTNKTLIASCDELRQAFSRAAILSNEKFRGVRVNLAGSEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V +   P++I FN  Y+L++++ +       ++V   +  +N+S  I
Sbjct: 295 NNPEQEEAEEMLDVTFEGDPIEIGFNVSYVLDVLNTLRC-----EKVQVSMSDANASALI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              D DS         A YV+MP+R+
Sbjct: 350 ENADDDS---------AMYVVMPIRL 366


>gi|315178625|gb|ADT85539.1| DNA polymerase III, beta chain [Vibrio furnissii NCTC 11218]
          Length = 366

 Score =  223 bits (569), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 124/386 (32%), Positives = 215/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ERS  ++ L      +  + T+P+  ++LL+  D  L + A+  E+E+   +   
Sbjct: 1   MKFTIERSHFIKPLQQVSGTLGGRATLPILGNLLLKVEDNQLSMTATDLEVELVSRVTLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D   G+ TV A    DI R L D A I+   E   G  V +  G S F L + P S+FP
Sbjct: 61  GDFEAGTTTVPARKFLDICRGLPDAAVITVVLE---GDRVQVRSGRSRFSLATLPASDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +      L    L+ LVE+T F+MA +++RYYLNG+ F I+   L+  +VATDGH
Sbjct: 118 NIEDWQSEVELSLTQGELRGLVEKTQFSMANQDVRYYLNGMLFEIDGSTLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AV++ ++ A  A    IIVPRK V E++++L + +  V + +  S +   + +   + 
Sbjct: 176 RMAVSQTELGADFAN-KQIIVPRKGVLELVKLLDALEQPVVLQIGSSNLRAEVNNFVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + +K L+  C  LRQA  R +I+S+ + + V+++L   ++ +T 
Sbjct: 235 KLVDGRFPDYRRVLPQNTNKTLQAGCDELRQAFSRAAILSNEKFRGVRVNLDGGEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V ++   ++I FN  Y+L++++ +       D V   +  +N+S  I
Sbjct: 295 NNPEQEEAEEMLDVNFDGEAIEIGFNVSYVLDVLNTLRC-----DNVRVSMSDANASALI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              D DS         A YV+MP+R+
Sbjct: 350 ENVDDDS---------AMYVVMPIRL 366


>gi|317494668|ref|ZP_07953080.1| DNA polymerase III [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917270|gb|EFV38617.1| DNA polymerase III [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 366

 Score =  223 bits (569), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 131/386 (33%), Positives = 218/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK  VER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +P A
Sbjct: 1   MKFIVEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVEDGHLLLTGTDLEMEMIARVPLA 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L DGA+I+   +   G  + +  G S F L + P ++FP
Sbjct: 61  QEHETGATTVPARKFFDICRGLPDGAEITVVLD---GDRMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATLKKLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E+ R+L   ++ +++ +  + I  ++     + 
Sbjct: 176 RLAVCSMPI-GQSVPSHSVIVPRKGVMELSRLLDGGETPLRLQIGSNNIRAHVGGFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L+  C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLKAGCDELKQAFARAAILSNEKFRGVRLYVSHNQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    ++I FN  Y+L++++ +       ++V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVNYEGTDLEIGFNVSYVLDVLNALKC-----EDVHMLLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       +A YV+MPMR+
Sbjct: 350 --EDAASQ-------SAAYVVMPMRL 366


>gi|15640045|ref|NP_062597.1| DNA polymerase III subunit beta [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121727891|ref|ZP_01680950.1| DNA polymerase III, beta chain [Vibrio cholerae V52]
 gi|147674757|ref|YP_001218399.1| DNA polymerase III subunit beta [Vibrio cholerae O395]
 gi|153819849|ref|ZP_01972516.1| DNA polymerase III, beta chain [Vibrio cholerae NCTC 8457]
 gi|153821934|ref|ZP_01974601.1| DNA polymerase III, beta chain [Vibrio cholerae B33]
 gi|227080250|ref|YP_002808801.1| DNA polymerase III, beta chain [Vibrio cholerae M66-2]
 gi|229508298|ref|ZP_04397802.1| DNA polymerase III beta subunit [Vibrio cholerae BX 330286]
 gi|229508863|ref|ZP_04398354.1| DNA polymerase III beta subunit [Vibrio cholerae B33]
 gi|229517134|ref|ZP_04406580.1| DNA polymerase III beta subunit [Vibrio cholerae RC9]
 gi|229606572|ref|YP_002877220.1| DNA polymerase III subunit beta [Vibrio cholerae MJ-1236]
 gi|254851578|ref|ZP_05240928.1| DNA polymerase III subunit beta [Vibrio cholerae MO10]
 gi|262155884|ref|ZP_06029006.1| DNA polymerase III beta subunit [Vibrio cholerae INDRE 91/1]
 gi|262167101|ref|ZP_06034816.1| DNA polymerase III beta subunit [Vibrio cholerae RC27]
 gi|298501198|ref|ZP_07010997.1| DNA polymerase III, beta subunit [Vibrio cholerae MAK 757]
 gi|14547987|sp|Q9KVX5|DPO3B_VIBCH RecName: Full=DNA polymerase III subunit beta
 gi|9654404|gb|AAF93191.1| DNA polymerase III, beta chain [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121629835|gb|EAX62250.1| DNA polymerase III, beta chain [Vibrio cholerae V52]
 gi|126509610|gb|EAZ72204.1| DNA polymerase III, beta chain [Vibrio cholerae NCTC 8457]
 gi|126520554|gb|EAZ77777.1| DNA polymerase III, beta chain [Vibrio cholerae B33]
 gi|146316640|gb|ABQ21179.1| DNA polymerase III, beta chain [Vibrio cholerae O395]
 gi|227008138|gb|ACP04350.1| DNA polymerase III, beta chain [Vibrio cholerae M66-2]
 gi|227011984|gb|ACP08194.1| DNA polymerase III, beta chain [Vibrio cholerae O395]
 gi|229346197|gb|EEO11169.1| DNA polymerase III beta subunit [Vibrio cholerae RC9]
 gi|229354138|gb|EEO19070.1| DNA polymerase III beta subunit [Vibrio cholerae B33]
 gi|229354571|gb|EEO19493.1| DNA polymerase III beta subunit [Vibrio cholerae BX 330286]
 gi|229369227|gb|ACQ59650.1| DNA polymerase III beta subunit [Vibrio cholerae MJ-1236]
 gi|254847283|gb|EET25697.1| DNA polymerase III subunit beta [Vibrio cholerae MO10]
 gi|262024487|gb|EEY43173.1| DNA polymerase III beta subunit [Vibrio cholerae RC27]
 gi|262030336|gb|EEY48978.1| DNA polymerase III beta subunit [Vibrio cholerae INDRE 91/1]
 gi|297540070|gb|EFH76132.1| DNA polymerase III, beta subunit [Vibrio cholerae MAK 757]
          Length = 366

 Score =  223 bits (568), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 122/386 (31%), Positives = 216/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ERS +++ L      +  + ++P+  ++LL+  +  L + A+  E+E+   +   
Sbjct: 1   MKFTIERSHLIKPLQQVSGTLGGRASLPILGNLLLKVEENQLSMTATDLEVELISRVTLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   GSITV A    DI R L D A I+   E   G  + +  G S F L + P S+FP
Sbjct: 61  GEFEAGSITVPARKFLDICRGLPDSAVITVLLE---GDRIQVRSGRSRFSLATLPASDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +      L  + L+ L+E+T F+MA +++RYYLNG+ F I+   L+  +VATDGH
Sbjct: 118 NIEDWQSEVQVSLTQAELRGLIEKTQFSMANQDVRYYLNGMLFEIDGTTLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AVA+  + A  A+   IIVPRK V E++++L + +  V + +  S +   +     + 
Sbjct: 176 RMAVAQAQLGADFAQ-KQIIVPRKGVLELVKLLDAPEQPVVLQIGHSNLRAEVNHFVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P    K L+  C  LRQA  R +I+S+ + + V+++L+ + + +T 
Sbjct: 235 KLVDGRFPDYRRVLPQHTSKTLQTGCEELRQAFSRAAILSNEKFRGVRVNLADNGMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V +   P++I FN  Y+L++++ +       D V   +  +N+S  +
Sbjct: 295 NNPEQEEAEELLDVSFEGEPIEIGFNVSYILDVLNTLRC-----DNVRVSMSDANASALV 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              D DS         A YV+MP+R+
Sbjct: 350 ENVDDDS---------AMYVVMPIRL 366


>gi|325915700|ref|ZP_08178005.1| DNA polymerase III, beta subunit [Xanthomonas vesicatoria ATCC
           35937]
 gi|325538117|gb|EGD09808.1| DNA polymerase III, beta subunit [Xanthomonas vesicatoria ATCC
           35937]
          Length = 366

 Score =  223 bits (568), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 126/385 (32%), Positives = 218/385 (56%), Gaps = 19/385 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ T++R   L+ L     ++ER+ T+PV  ++L+Q  DG + +  +  E+E+       
Sbjct: 1   MRFTLQREAFLKPLAQVVNVVERRQTLPVLANLLVQVKDGQVSLTGTDLEVEMISRTMVE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               G  T+ A  L+DI+R L DG++++    ++ G +V +  G S F L + P ++FPS
Sbjct: 61  DAQDGETTIPARKLFDILRALPDGSRVTI---SQTGDKVTVQAGRSRFTLATLPANDFPS 117

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
             E E      +  + LK L+ERT FAMA +++RYYLNG+ F + +  L+ C VATDGHR
Sbjct: 118 VDEVEATERVAVPEAALKELIERTAFAMAQQDVRYYLNGLLFDLRDGLLR-C-VATDGHR 175

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LA+ E ++         IIVPRK V E+LR+L + D  V++ +  S I +    ++ + +
Sbjct: 176 LALCETELEKAGGAKRQIIVPRKGVTELLRLLEAADREVELEVGRSHIRVKRGDVTFTSK 235

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDG FP+Y+ VIP   D+E++V+   LR ++ R +I+S+ + + V++ +S  +L ++  
Sbjct: 236 LIDGRFPDYEAVIPIGADREVKVDREALRASLQRAAILSNEKYRGVRVEVSPGQLKISAH 295

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           NP+  +A E +        + I FN  YLL+ +  +      D+ VV +L  +NSS  +R
Sbjct: 296 NPEQEEAQEEIEADTKVDDLAIGFNVNYLLDALSALR-----DEHVVIQLRDANSSALVR 350

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
             +  S+ ++       +V+MP+R+
Sbjct: 351 --EASSEKSR-------HVVMPLRL 366


>gi|91228347|ref|ZP_01262275.1| DNA polymerase III subunit beta [Vibrio alginolyticus 12G01]
 gi|91188107|gb|EAS74411.1| DNA polymerase III subunit beta [Vibrio alginolyticus 12G01]
          Length = 366

 Score =  223 bits (568), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 121/386 (31%), Positives = 222/386 (57%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ERS +++ L      +  + T+P+  ++LL+  + +L + A+  E+E+   +   
Sbjct: 1   MKFTIERSHLIKPLQQVSGALGGRPTLPILGNLLLKVEENVLSMTATDLEVELVSKVMLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D   GSITV +    DI R L D A I+F  E   G  V +  G S F L + P ++FP
Sbjct: 61  GDFEAGSITVPSRKFLDICRGLPDDAIITFVLE---GDRVQVRSGRSRFSLATLPANDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +      L+ + L+ L+++T F+MA +++RYYLNG+ F I+   L+  +VATDGH
Sbjct: 118 NIEDWQSEVEVSLSQADLRTLIDKTQFSMANQDVRYYLNGMLFEIDGTTLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AV++  + A  A+   IIVPRK V E+++++ + +  V + +  S +   + + + + 
Sbjct: 176 RMAVSQTQLGADFAQ-KQIIVPRKGVQELVKLMDAPEQPVVLQIGSSNVRAEVNNFTFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P S +K L  +C  LRQA  R +I+S+ + + V+++L+  ++ +T 
Sbjct: 235 KLVDGRFPDYRRVLPQSTNKTLIASCDELRQAFSRAAILSNEKFRGVRVNLADTEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V +    ++I FN  Y+L++++ +       + V   +  +N+S  I
Sbjct: 295 NNPEQEEAEEMLDVTFEGDAIEIGFNVSYVLDVLNTLRC-----ENVRVSMSDANASALI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              D DS         A YV+MP+R+
Sbjct: 350 ENADDDS---------AMYVVMPIRL 366


>gi|83642916|ref|YP_431351.1| DNA polymerase III subunit beta [Hahella chejuensis KCTC 2396]
 gi|83630959|gb|ABC26926.1| DNA polymerase III, beta subunit [Hahella chejuensis KCTC 2396]
          Length = 367

 Score =  223 bits (568), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 131/387 (33%), Positives = 212/387 (54%), Gaps = 22/387 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK+T+ R  ++  L     ++E++ T+PV  +VLL A DG L I  +  E+E+   I   
Sbjct: 1   MKLTITREALVTSLQMISGVVEKRQTMPVLANVLLDARDGKLVITGTNMEVELVAEISDV 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESEF 118
           +++    ITV A    DI R L +GA I    K+  L    N+ +G S+F L + P   F
Sbjct: 61  NIEHESRITVPAKKFTDICRALPEGAAIGIELKDGRL----NVRYGSSHFILSTLPAEHF 116

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P+ +EE       L    LK L++ T FAMA +++RYYLNG+   ++E+ L+   VATDG
Sbjct: 117 PNVEEEPESVKVTLPQRELKRLIDATAFAMAQQDVRYYLNGMLMELDEQGLR--TVATDG 174

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA+A V +   +++    IVPRK + E+ R+L+  D S  +   ++ +  ++   + +
Sbjct: 175 HRLALANVSLQTGVSEKRQPIVPRKGILELGRLLNDTDESCTLVFGDNHVRASVGHFTFT 234

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG+FP+YQ VIP S DK +  +   L+  + R SI+S   I+ V+L      L + 
Sbjct: 235 SKLIDGKFPDYQRVIPRSGDKVMLADRVLLKGVLSRASILSHESIRGVRLQFEEGLLKVF 294

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
            +NPD  +A +S+ V Y    + I FN  YL+++++ +      D++V   L ++NSS  
Sbjct: 295 ANNPDQEEAEDSLEVEYPHEALQIGFNVGYLIDVLNALD-----DEQVKVTLSNANSSAL 349

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + G D           +A YV+MPMR+
Sbjct: 350 VEGVDTR---------DAVYVVMPMRL 367


>gi|325499508|gb|EGC97367.1| DNA polymerase III subunit beta [Escherichia fergusonii ECD227]
          Length = 366

 Score =  223 bits (568), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 132/386 (34%), Positives = 217/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +   
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALV 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E E    + +  G S F L + P ++FP
Sbjct: 61  QPHEPGTTTVPARKFFDICRGLPEGAEIAVQLEGE---RMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E++R+L   D+ ++V +  + I  ++     + 
Sbjct: 176 RLAVCSMPI-GQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y+   M+I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVTYSGAEMEIGFNVSYVLDVLNALKC-----ENVRMMLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       +A YV+MPMR+
Sbjct: 350 --EDAASQ-------SAAYVVMPMRL 366


>gi|183597171|ref|ZP_02958664.1| hypothetical protein PROSTU_00414 [Providencia stuartii ATCC 25827]
 gi|188023485|gb|EDU61525.1| hypothetical protein PROSTU_00414 [Providencia stuartii ATCC 25827]
          Length = 366

 Score =  223 bits (568), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 130/386 (33%), Positives = 222/386 (57%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ER  +L+ L      +  + T+P+  ++LLQ  +G L +  +  E+E+   +P +
Sbjct: 1   MKFTIEREQLLKPLQQVSGPLGGRPTLPILGNLLLQVKEGALLLTGTDLEMEMMAHVPLT 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   G+ TV A   +DI R L +G++I    +++    + +  G S F L + P ++FP
Sbjct: 61  QEHDVGATTVPARKFFDIWRGLPEGSEIRVELDDD---RLLVRSGRSRFSLSTLPATDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  S+LK L+E T F+MA +++RYYLNG+ F    + L+   V+TDGH
Sbjct: 118 NLDDWQSEVEFSLPQSILKRLIEATQFSMAHQDVRYYLNGMLFETEGQLLR--TVSTDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  +DI  Q     S+IVPRK V E++R+L   D+ V++ +  + I  ++     + 
Sbjct: 176 RLAVCAMDI-GQDLPSHSVIVPRKGVIELMRLLDGGDTPVQLQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L  S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLEARCDLLKQAFSRAAILSNEKFRGVRLYFSENQLRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ + S+ V     +F  D+  SSV I
Sbjct: 295 NNPEQEEAEEIVDVNYQGTEMEIGFNVSYILDVLNALKSENV----TLFLTDAV-SSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
               +DS ++      A YV+MPMR+
Sbjct: 350 ----EDSASSA-----AVYVVMPMRL 366


>gi|15804295|ref|NP_290334.1| DNA polymerase III subunit beta [Escherichia coli O157:H7 EDL933]
 gi|15833890|ref|NP_312663.1| DNA polymerase III subunit beta [Escherichia coli O157:H7 str.
           Sakai]
 gi|16131569|ref|NP_418156.1| DNA polymerase III, beta subunit [Escherichia coli str. K-12
           substr. MG1655]
 gi|26250442|ref|NP_756482.1| DNA polymerase III subunit beta [Escherichia coli CFT073]
 gi|74314015|ref|YP_312434.1| DNA polymerase III subunit beta [Shigella sonnei Ss046]
 gi|82546035|ref|YP_409982.1| DNA polymerase III subunit beta [Shigella boydii Sb227]
 gi|82779230|ref|YP_405579.1| DNA polymerase III subunit beta [Shigella dysenteriae Sd197]
 gi|89110312|ref|AP_004092.1| DNA polymerase III, beta subunit [Escherichia coli str. K-12
           substr. W3110]
 gi|91213223|ref|YP_543209.1| DNA polymerase III subunit beta [Escherichia coli UTI89]
 gi|110644044|ref|YP_671774.1| DNA polymerase III subunit beta [Escherichia coli 536]
 gi|117625977|ref|YP_859300.1| DNA polymerase III subunit beta [Escherichia coli APEC O1]
 gi|157156673|ref|YP_001465186.1| DNA polymerase III subunit beta [Escherichia coli E24377A]
 gi|157163181|ref|YP_001460499.1| DNA polymerase III subunit beta [Escherichia coli HS]
 gi|168748583|ref|ZP_02773605.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str.
           EC4113]
 gi|168753590|ref|ZP_02778597.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str.
           EC4401]
 gi|168759887|ref|ZP_02784894.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str.
           EC4501]
 gi|168766188|ref|ZP_02791195.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str.
           EC4486]
 gi|168772264|ref|ZP_02797271.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str.
           EC4196]
 gi|168779923|ref|ZP_02804930.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str.
           EC4076]
 gi|168798736|ref|ZP_02823743.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str.
           EC508]
 gi|170018063|ref|YP_001723017.1| DNA polymerase III subunit beta [Escherichia coli ATCC 8739]
 gi|170083203|ref|YP_001732523.1| DNA polymerase III, beta subunit [Escherichia coli str. K-12
           substr. DH10B]
 gi|170682488|ref|YP_001746029.1| DNA polymerase III subunit beta [Escherichia coli SMS-3-5]
 gi|187730327|ref|YP_001882465.1| DNA polymerase III subunit beta [Shigella boydii CDC 3083-94]
 gi|188492542|ref|ZP_02999812.1| DNA polymerase III, beta subunit [Escherichia coli 53638]
 gi|191165808|ref|ZP_03027646.1| DNA polymerase III, beta subunit [Escherichia coli B7A]
 gi|191170441|ref|ZP_03031994.1| DNA polymerase III, beta subunit [Escherichia coli F11]
 gi|193063787|ref|ZP_03044874.1| DNA polymerase III, beta subunit [Escherichia coli E22]
 gi|194428142|ref|ZP_03060686.1| DNA polymerase III, beta subunit [Escherichia coli B171]
 gi|194431323|ref|ZP_03063616.1| DNA polymerase III, beta subunit [Shigella dysenteriae 1012]
 gi|194435912|ref|ZP_03068015.1| DNA polymerase III, beta subunit [Escherichia coli 101-1]
 gi|195936322|ref|ZP_03081704.1| DNA polymerase III subunit beta [Escherichia coli O157:H7 str.
           EC4024]
 gi|208807282|ref|ZP_03249619.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str.
           EC4206]
 gi|208813217|ref|ZP_03254546.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str.
           EC4045]
 gi|208820496|ref|ZP_03260816.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str.
           EC4042]
 gi|209400437|ref|YP_002273227.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str.
           EC4115]
 gi|209921178|ref|YP_002295262.1| DNA polymerase III subunit beta [Escherichia coli SE11]
 gi|217324148|ref|ZP_03440232.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str.
           TW14588]
 gi|218551231|ref|YP_002385023.1| DNA polymerase III subunit beta [Escherichia fergusonii ATCC 35469]
 gi|218556266|ref|YP_002389180.1| DNA polymerase III subunit beta [Escherichia coli IAI1]
 gi|218560776|ref|YP_002393689.1| DNA polymerase III subunit beta [Escherichia coli S88]
 gi|218691989|ref|YP_002400201.1| DNA polymerase III subunit beta [Escherichia coli ED1a]
 gi|218697423|ref|YP_002405090.1| DNA polymerase III subunit beta [Escherichia coli 55989]
 gi|218702550|ref|YP_002410179.1| DNA polymerase III subunit beta [Escherichia coli IAI39]
 gi|218707347|ref|YP_002414866.1| DNA polymerase III subunit beta [Escherichia coli UMN026]
 gi|227883922|ref|ZP_04001727.1| DNA-directed DNA polymerase [Escherichia coli 83972]
 gi|237703501|ref|ZP_04533982.1| DNA polymerase III subunit beta [Escherichia sp. 3_2_53FAA]
 gi|238902791|ref|YP_002928587.1| DNA polymerase III, beta subunit [Escherichia coli BW2952]
 gi|253771437|ref|YP_003034268.1| DNA polymerase III subunit beta [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254038918|ref|ZP_04872970.1| DNA polymerase III [Escherichia sp. 1_1_43]
 gi|254163652|ref|YP_003046760.1| DNA polymerase III subunit beta [Escherichia coli B str. REL606]
 gi|254795704|ref|YP_003080541.1| DNA polymerase III subunit beta [Escherichia coli O157:H7 str.
           TW14359]
 gi|256021281|ref|ZP_05435146.1| DNA polymerase III subunit beta [Shigella sp. D9]
 gi|256025568|ref|ZP_05439433.1| DNA polymerase III subunit beta [Escherichia sp. 4_1_40B]
 gi|260846514|ref|YP_003224292.1| DNA polymerase III, beta subunit [Escherichia coli O103:H2 str.
           12009]
 gi|260857888|ref|YP_003231779.1| DNA polymerase III, beta subunit [Escherichia coli O26:H11 str.
           11368]
 gi|260870432|ref|YP_003236834.1| DNA polymerase III, beta subunit [Escherichia coli O111:H- str.
           11128]
 gi|261225854|ref|ZP_05940135.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261258899|ref|ZP_05951432.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291285120|ref|YP_003501938.1| DNA polymerase III subunit beta [Escherichia coli O55:H7 str.
           CB9615]
 gi|293407341|ref|ZP_06651263.1| DNA polymerase III subunit beta [Escherichia coli FVEC1412]
 gi|293413155|ref|ZP_06655821.1| DNA polymerase III [Escherichia coli B354]
 gi|293417174|ref|ZP_06659801.1| DNA polymerase III [Escherichia coli B185]
 gi|297518856|ref|ZP_06937242.1| DNA polymerase III subunit beta [Escherichia coli OP50]
 gi|298383082|ref|ZP_06992677.1| DNA polymerase III subunit beta [Escherichia coli FVEC1302]
 gi|300824314|ref|ZP_07104430.1| DNA polymerase III, beta subunit [Escherichia coli MS 119-7]
 gi|300896030|ref|ZP_07114591.1| DNA polymerase III, beta subunit [Escherichia coli MS 198-1]
 gi|300903024|ref|ZP_07120966.1| DNA polymerase III, beta subunit [Escherichia coli MS 84-1]
 gi|300917469|ref|ZP_07134129.1| DNA polymerase III, beta subunit [Escherichia coli MS 115-1]
 gi|300925525|ref|ZP_07141400.1| DNA polymerase III, beta subunit [Escherichia coli MS 182-1]
 gi|300932332|ref|ZP_07147600.1| DNA polymerase III, beta subunit [Escherichia coli MS 187-1]
 gi|300940886|ref|ZP_07155413.1| DNA polymerase III, beta subunit [Escherichia coli MS 21-1]
 gi|300947538|ref|ZP_07161715.1| DNA polymerase III, beta subunit [Escherichia coli MS 116-1]
 gi|300956293|ref|ZP_07168595.1| DNA polymerase III, beta subunit [Escherichia coli MS 175-1]
 gi|300983652|ref|ZP_07176693.1| DNA polymerase III, beta subunit [Escherichia coli MS 200-1]
 gi|300984541|ref|ZP_07177031.1| DNA polymerase III, beta subunit [Escherichia coli MS 45-1]
 gi|301020910|ref|ZP_07184965.1| DNA polymerase III, beta subunit [Escherichia coli MS 69-1]
 gi|301028494|ref|ZP_07191734.1| DNA polymerase III, beta subunit [Escherichia coli MS 196-1]
 gi|301047519|ref|ZP_07194595.1| DNA polymerase III, beta subunit [Escherichia coli MS 185-1]
 gi|301305953|ref|ZP_07212035.1| DNA polymerase III, beta subunit [Escherichia coli MS 124-1]
 gi|301325007|ref|ZP_07218557.1| DNA polymerase III, beta subunit [Escherichia coli MS 78-1]
 gi|301644373|ref|ZP_07244374.1| DNA polymerase III, beta subunit [Escherichia coli MS 146-1]
 gi|306815946|ref|ZP_07450084.1| DNA polymerase III subunit beta [Escherichia coli NC101]
 gi|307140401|ref|ZP_07499757.1| DNA polymerase III subunit beta [Escherichia coli H736]
 gi|307313230|ref|ZP_07592855.1| DNA polymerase III, beta subunit [Escherichia coli W]
 gi|309784249|ref|ZP_07678888.1| DNA polymerase III, beta subunit [Shigella dysenteriae 1617]
 gi|309795750|ref|ZP_07690165.1| DNA polymerase III, beta subunit [Escherichia coli MS 145-7]
 gi|312972007|ref|ZP_07786181.1| DNA polymerase III, beta subunit [Escherichia coli 1827-70]
 gi|331644425|ref|ZP_08345554.1| DNA polymerase III, beta subunit [Escherichia coli H736]
 gi|331649527|ref|ZP_08350613.1| DNA polymerase III, beta subunit [Escherichia coli M605]
 gi|331655361|ref|ZP_08356360.1| DNA polymerase III, beta subunit [Escherichia coli M718]
 gi|331660043|ref|ZP_08360981.1| DNA polymerase III, beta subunit [Escherichia coli TA206]
 gi|331665351|ref|ZP_08366252.1| DNA polymerase III, beta subunit [Escherichia coli TA143]
 gi|331670545|ref|ZP_08371384.1| DNA polymerase III, beta subunit [Escherichia coli TA271]
 gi|331675191|ref|ZP_08375944.1| DNA polymerase III, beta subunit [Escherichia coli TA280]
 gi|331679799|ref|ZP_08380469.1| DNA polymerase III, beta subunit [Escherichia coli H591]
 gi|331685425|ref|ZP_08386011.1| DNA polymerase III, beta subunit [Escherichia coli H299]
 gi|332282512|ref|ZP_08394925.1| DNA polymerase III subunit beta [Shigella sp. D9]
 gi|71159295|sp|P0A990|DPO3B_ECO57 RecName: Full=DNA polymerase III subunit beta
 gi|71159296|sp|P0A989|DPO3B_ECOL6 RecName: Full=DNA polymerase III subunit beta
 gi|71159297|sp|P0A988|DPO3B_ECOLI RecName: Full=DNA polymerase III subunit beta
 gi|494833|pdb|2POL|A Chain A, Three-Dimensional Structure Of The Beta Subunit Of
           Escherichia Coli Dna Polymerase Iii Holoenzyme: A
           Sliding Dna Clamp
 gi|494834|pdb|2POL|B Chain B, Three-Dimensional Structure Of The Beta Subunit Of
           Escherichia Coli Dna Polymerase Iii Holoenzyme: A
           Sliding Dna Clamp
 gi|34809863|pdb|1MMI|A Chain A, E. Coli Dna Polymerase Beta Subunit
 gi|34809864|pdb|1MMI|B Chain B, E. Coli Dna Polymerase Beta Subunit
 gi|39654966|pdb|1UNN|A Chain A, Complex Of Beta-Clamp Processivity Factor And Little
           Finger Domain Of Poliv
 gi|39654967|pdb|1UNN|B Chain B, Complex Of Beta-Clamp Processivity Factor And Little
           Finger Domain Of Poliv
 gi|51247132|pdb|1OK7|A Chain A, A Conserved Protein Binding-Site On Bacterial Sliding
           Clamps
 gi|51247133|pdb|1OK7|B Chain B, A Conserved Protein Binding-Site On Bacterial Sliding
           Clamps
 gi|166235467|pdb|3BEP|A Chain A, Structure Of A Sliding Clamp On Dna
 gi|166235468|pdb|3BEP|B Chain B, Structure Of A Sliding Clamp On Dna
 gi|194709177|pdb|3D1E|A Chain A, Crystal Structure Of E. Coli Sliding Clamp (Beta) Bound To
           A Polymerase Ii Peptide
 gi|194709178|pdb|3D1E|B Chain B, Crystal Structure Of E. Coli Sliding Clamp (Beta) Bound To
           A Polymerase Ii Peptide
 gi|194709180|pdb|3D1F|A Chain A, Crystal Structure Of E. Coli Sliding Clamp (Beta) Bound To
           A Polymerase Iii Peptide
 gi|194709181|pdb|3D1F|B Chain B, Crystal Structure Of E. Coli Sliding Clamp (Beta) Bound To
           A Polymerase Iii Peptide
 gi|194709184|pdb|3D1G|A Chain A, Structure Of A Small Molecule Inhibitor Bound To A Dna
           Sliding Clamp
 gi|194709185|pdb|3D1G|B Chain B, Structure Of A Small Molecule Inhibitor Bound To A Dna
           Sliding Clamp
 gi|12518540|gb|AAG58898.1|AE005601_4 DNA polymerase III, beta-subunit [Escherichia coli O157:H7 str.
           EDL933]
 gi|26110872|gb|AAN83056.1|AE016769_171 DNA polymerase III, beta chain [Escherichia coli CFT073]
 gi|145761|gb|AAB59150.1| DNA polymerase III beta-subunit [Escherichia coli]
 gi|290549|gb|AAA62052.1| DNA polymerase III beta-subunit [Escherichia coli]
 gi|1790136|gb|AAC76724.1| DNA polymerase III, beta subunit [Escherichia coli str. K-12
           substr. MG1655]
 gi|13364111|dbj|BAB38059.1| DNA polymerase III beta-subunit [Escherichia coli O157:H7 str.
           Sakai]
 gi|73857492|gb|AAZ90199.1| DNA polymerase III beta subunit [Shigella sonnei Ss046]
 gi|81243378|gb|ABB64088.1| DNA polymerase III, beta-subunit [Shigella dysenteriae Sd197]
 gi|81247446|gb|ABB68154.1| DNA polymerase III beta-subunit [Shigella boydii Sb227]
 gi|85676343|dbj|BAE77593.1| DNA polymerase III, beta subunit [Escherichia coli str. K12 substr.
           W3110]
 gi|91074797|gb|ABE09678.1| DNA polymerase III, beta-subunit [Escherichia coli UTI89]
 gi|110345636|gb|ABG71873.1| DNA polymerase III, beta chain [Escherichia coli 536]
 gi|115515101|gb|ABJ03176.1| DNA polymerase III subunit beta [Escherichia coli APEC O1]
 gi|157068861|gb|ABV08116.1| DNA polymerase III, beta subunit [Escherichia coli HS]
 gi|157078703|gb|ABV18411.1| DNA polymerase III, beta subunit [Escherichia coli E24377A]
 gi|169752991|gb|ACA75690.1| DNA polymerase III, beta subunit [Escherichia coli ATCC 8739]
 gi|169891038|gb|ACB04745.1| DNA polymerase III, beta subunit [Escherichia coli str. K-12
           substr. DH10B]
 gi|170520206|gb|ACB18384.1| DNA polymerase III, beta subunit [Escherichia coli SMS-3-5]
 gi|187427319|gb|ACD06593.1| DNA polymerase III, beta subunit [Shigella boydii CDC 3083-94]
 gi|187771361|gb|EDU35205.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str.
           EC4196]
 gi|188016968|gb|EDU55090.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str.
           EC4113]
 gi|188487741|gb|EDU62844.1| DNA polymerase III, beta subunit [Escherichia coli 53638]
 gi|189002623|gb|EDU71609.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str.
           EC4076]
 gi|189359039|gb|EDU77458.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str.
           EC4401]
 gi|189364639|gb|EDU83058.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str.
           EC4486]
 gi|189369478|gb|EDU87894.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str.
           EC4501]
 gi|189378717|gb|EDU97133.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str.
           EC508]
 gi|190904132|gb|EDV63843.1| DNA polymerase III, beta subunit [Escherichia coli B7A]
 gi|190909249|gb|EDV68835.1| DNA polymerase III, beta subunit [Escherichia coli F11]
 gi|192930502|gb|EDV83109.1| DNA polymerase III, beta subunit [Escherichia coli E22]
 gi|194413900|gb|EDX30178.1| DNA polymerase III, beta subunit [Escherichia coli B171]
 gi|194420778|gb|EDX36854.1| DNA polymerase III, beta subunit [Shigella dysenteriae 1012]
 gi|194425455|gb|EDX41439.1| DNA polymerase III, beta subunit [Escherichia coli 101-1]
 gi|208727083|gb|EDZ76684.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str.
           EC4206]
 gi|208734494|gb|EDZ83181.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str.
           EC4045]
 gi|208740619|gb|EDZ88301.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str.
           EC4042]
 gi|209161837|gb|ACI39270.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str.
           EC4115]
 gi|209754118|gb|ACI75366.1| replication initiation protein DnaA [Escherichia coli]
 gi|209754120|gb|ACI75367.1| replication initiation protein DnaA [Escherichia coli]
 gi|209754122|gb|ACI75368.1| replication initiation protein DnaA [Escherichia coli]
 gi|209754124|gb|ACI75369.1| replication initiation protein DnaA [Escherichia coli]
 gi|209754126|gb|ACI75370.1| replication initiation protein DnaA [Escherichia coli]
 gi|209914437|dbj|BAG79511.1| DNA polymerase III beta subunit [Escherichia coli SE11]
 gi|217320369|gb|EEC28793.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str.
           TW14588]
 gi|218354155|emb|CAV00755.1| DNA polymerase III, beta subunit [Escherichia coli 55989]
 gi|218358773|emb|CAQ91430.1| DNA polymerase III, beta subunit [Escherichia fergusonii ATCC
           35469]
 gi|218363035|emb|CAR00674.1| DNA polymerase III, beta subunit [Escherichia coli IAI1]
 gi|218367545|emb|CAR05330.1| DNA polymerase III, beta subunit [Escherichia coli S88]
 gi|218372536|emb|CAR20411.1| DNA polymerase III, beta subunit [Escherichia coli IAI39]
 gi|218429553|emb|CAR10376.1| DNA polymerase III, beta subunit [Escherichia coli ED1a]
 gi|218434444|emb|CAR15372.1| DNA polymerase III, beta subunit [Escherichia coli UMN026]
 gi|222035415|emb|CAP78160.1| DNA polymerase III subunit beta [Escherichia coli LF82]
 gi|226838883|gb|EEH70910.1| DNA polymerase III [Escherichia sp. 1_1_43]
 gi|226902765|gb|EEH89024.1| DNA polymerase III subunit beta [Escherichia sp. 3_2_53FAA]
 gi|227839200|gb|EEJ49666.1| DNA-directed DNA polymerase [Escherichia coli 83972]
 gi|238860831|gb|ACR62829.1| DNA polymerase III, beta subunit [Escherichia coli BW2952]
 gi|242379240|emb|CAQ34045.1| dnaN, subunit of DNA polymerase III, beta subunit and DNA
           polymerase III, holoenzyme [Escherichia coli BL21(DE3)]
 gi|253322481|gb|ACT27083.1| DNA polymerase III, beta subunit [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253975553|gb|ACT41224.1| DNA polymerase III subunit beta [Escherichia coli B str. REL606]
 gi|253979709|gb|ACT45379.1| DNA polymerase III subunit beta [Escherichia coli BL21(DE3)]
 gi|254595104|gb|ACT74465.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str.
           TW14359]
 gi|257756537|dbj|BAI28039.1| DNA polymerase III, beta subunit [Escherichia coli O26:H11 str.
           11368]
 gi|257761661|dbj|BAI33158.1| DNA polymerase III, beta subunit [Escherichia coli O103:H2 str.
           12009]
 gi|257766788|dbj|BAI38283.1| DNA polymerase III, beta subunit [Escherichia coli O111:H- str.
           11128]
 gi|260447281|gb|ACX37703.1| DNA polymerase III, beta subunit [Escherichia coli DH1]
 gi|281180755|dbj|BAI57085.1| DNA polymerase III beta subunit [Escherichia coli SE15]
 gi|290764993|gb|ADD58954.1| DNA polymerase III subunit beta [Escherichia coli O55:H7 str.
           CB9615]
 gi|291425632|gb|EFE98668.1| DNA polymerase III subunit beta [Escherichia coli FVEC1412]
 gi|291431205|gb|EFF04198.1| DNA polymerase III [Escherichia coli B185]
 gi|291468288|gb|EFF10783.1| DNA polymerase III [Escherichia coli B354]
 gi|294492870|gb|ADE91626.1| DNA polymerase III, beta subunit [Escherichia coli IHE3034]
 gi|298276918|gb|EFI18436.1| DNA polymerase III subunit beta [Escherichia coli FVEC1302]
 gi|299878456|gb|EFI86667.1| DNA polymerase III, beta subunit [Escherichia coli MS 196-1]
 gi|300300579|gb|EFJ56964.1| DNA polymerase III, beta subunit [Escherichia coli MS 185-1]
 gi|300306875|gb|EFJ61395.1| DNA polymerase III, beta subunit [Escherichia coli MS 200-1]
 gi|300316880|gb|EFJ66664.1| DNA polymerase III, beta subunit [Escherichia coli MS 175-1]
 gi|300360090|gb|EFJ75960.1| DNA polymerase III, beta subunit [Escherichia coli MS 198-1]
 gi|300398377|gb|EFJ81915.1| DNA polymerase III, beta subunit [Escherichia coli MS 69-1]
 gi|300404930|gb|EFJ88468.1| DNA polymerase III, beta subunit [Escherichia coli MS 84-1]
 gi|300408374|gb|EFJ91912.1| DNA polymerase III, beta subunit [Escherichia coli MS 45-1]
 gi|300415273|gb|EFJ98583.1| DNA polymerase III, beta subunit [Escherichia coli MS 115-1]
 gi|300418365|gb|EFK01676.1| DNA polymerase III, beta subunit [Escherichia coli MS 182-1]
 gi|300452875|gb|EFK16495.1| DNA polymerase III, beta subunit [Escherichia coli MS 116-1]
 gi|300454367|gb|EFK17860.1| DNA polymerase III, beta subunit [Escherichia coli MS 21-1]
 gi|300459918|gb|EFK23411.1| DNA polymerase III, beta subunit [Escherichia coli MS 187-1]
 gi|300523201|gb|EFK44270.1| DNA polymerase III, beta subunit [Escherichia coli MS 119-7]
 gi|300838804|gb|EFK66564.1| DNA polymerase III, beta subunit [Escherichia coli MS 124-1]
 gi|300848101|gb|EFK75861.1| DNA polymerase III, beta subunit [Escherichia coli MS 78-1]
 gi|301077314|gb|EFK92120.1| DNA polymerase III, beta subunit [Escherichia coli MS 146-1]
 gi|305850342|gb|EFM50799.1| DNA polymerase III subunit beta [Escherichia coli NC101]
 gi|306906913|gb|EFN37422.1| DNA polymerase III, beta subunit [Escherichia coli W]
 gi|307555841|gb|ADN48616.1| DNA polymerase III, beta-subunit [Escherichia coli ABU 83972]
 gi|307628777|gb|ADN73081.1| DNA polymerase III subunit beta [Escherichia coli UM146]
 gi|308120629|gb|EFO57891.1| DNA polymerase III, beta subunit [Escherichia coli MS 145-7]
 gi|308927756|gb|EFP73224.1| DNA polymerase III, beta subunit [Shigella dysenteriae 1617]
 gi|309704148|emb|CBJ03495.1| DNA polymerase III beta-subunit [Escherichia coli ETEC H10407]
 gi|310334384|gb|EFQ00589.1| DNA polymerase III, beta subunit [Escherichia coli 1827-70]
 gi|312948268|gb|ADR29095.1| DNA polymerase III subunit beta [Escherichia coli O83:H1 str. NRG
           857C]
 gi|315063007|gb|ADT77334.1| DNA polymerase III, beta subunit [Escherichia coli W]
 gi|315138285|dbj|BAJ45444.1| DNA polymerase III subunit beta [Escherichia coli DH1]
 gi|315254612|gb|EFU34580.1| DNA polymerase III, beta subunit [Escherichia coli MS 85-1]
 gi|315285494|gb|EFU44939.1| DNA polymerase III, beta subunit [Escherichia coli MS 110-3]
 gi|315292859|gb|EFU52211.1| DNA polymerase III, beta subunit [Escherichia coli MS 153-1]
 gi|315296899|gb|EFU56187.1| DNA polymerase III, beta subunit [Escherichia coli MS 16-3]
 gi|315618593|gb|EFU99179.1| DNA polymerase III, beta subunit [Escherichia coli 3431]
 gi|320174825|gb|EFW49948.1| DNA polymerase III beta subunit [Shigella dysenteriae CDC 74-1112]
 gi|320180042|gb|EFW54984.1| DNA polymerase III beta subunit [Shigella boydii ATCC 9905]
 gi|320185534|gb|EFW60300.1| DNA polymerase III beta subunit [Shigella flexneri CDC 796-83]
 gi|320191199|gb|EFW65849.1| DNA polymerase III beta subunit [Escherichia coli O157:H7 str.
           EC1212]
 gi|320193753|gb|EFW68386.1| DNA polymerase III beta subunit [Escherichia coli WV_060327]
 gi|320201271|gb|EFW75852.1| DNA polymerase III beta subunit [Escherichia coli EC4100B]
 gi|320639426|gb|EFX09041.1| DNA polymerase III subunit beta [Escherichia coli O157:H7 str.
           G5101]
 gi|320644869|gb|EFX13905.1| DNA polymerase III subunit beta [Escherichia coli O157:H- str.
           493-89]
 gi|320650133|gb|EFX18629.1| DNA polymerase III subunit beta [Escherichia coli O157:H- str. H
           2687]
 gi|320655481|gb|EFX23416.1| DNA polymerase III subunit beta [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320661107|gb|EFX28543.1| DNA polymerase III subunit beta [Escherichia coli O55:H7 str. USDA
           5905]
 gi|320666233|gb|EFX33239.1| DNA polymerase III subunit beta [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323155377|gb|EFZ41560.1| DNA polymerase III, beta subunit [Escherichia coli EPECa14]
 gi|323161047|gb|EFZ46966.1| DNA polymerase III, beta subunit [Escherichia coli E128010]
 gi|323164687|gb|EFZ50482.1| DNA polymerase III, beta subunit [Shigella sonnei 53G]
 gi|323173319|gb|EFZ58948.1| DNA polymerase III, beta subunit [Escherichia coli LT-68]
 gi|323177713|gb|EFZ63297.1| DNA polymerase III, beta subunit [Escherichia coli 1180]
 gi|323182496|gb|EFZ67900.1| DNA polymerase III, beta subunit [Escherichia coli 1357]
 gi|323189564|gb|EFZ74844.1| DNA polymerase III, beta subunit [Escherichia coli RN587/1]
 gi|323376399|gb|ADX48667.1| DNA polymerase III, beta subunit [Escherichia coli KO11]
 gi|323934948|gb|EGB31326.1| DNA polymerase III [Escherichia coli E1520]
 gi|323949944|gb|EGB45828.1| DNA polymerase III [Escherichia coli H252]
 gi|323955005|gb|EGB50783.1| DNA polymerase III [Escherichia coli H263]
 gi|323959766|gb|EGB55416.1| DNA polymerase III [Escherichia coli H489]
 gi|323965762|gb|EGB61213.1| DNA polymerase III [Escherichia coli M863]
 gi|323971178|gb|EGB66424.1| DNA polymerase III [Escherichia coli TA007]
 gi|323975232|gb|EGB70336.1| DNA polymerase III [Escherichia coli TW10509]
 gi|324008037|gb|EGB77256.1| DNA polymerase III, beta subunit [Escherichia coli MS 57-2]
 gi|324012738|gb|EGB81957.1| DNA polymerase III, beta subunit [Escherichia coli MS 60-1]
 gi|324018431|gb|EGB87650.1| DNA polymerase III, beta subunit [Escherichia coli MS 117-3]
 gi|324115947|gb|EGC09873.1| DNA polymerase III [Escherichia coli E1167]
 gi|326337250|gb|EGD61085.1| DNA polymerase III beta subunit [Escherichia coli O157:H7 str.
           1044]
 gi|326341621|gb|EGD65410.1| DNA polymerase III beta subunit [Escherichia coli O157:H7 str.
           1125]
 gi|327250844|gb|EGE62546.1| DNA polymerase III, beta subunit [Escherichia coli STEC_7v]
 gi|331036719|gb|EGI08945.1| DNA polymerase III, beta subunit [Escherichia coli H736]
 gi|331042025|gb|EGI14169.1| DNA polymerase III, beta subunit [Escherichia coli M605]
 gi|331047376|gb|EGI19454.1| DNA polymerase III, beta subunit [Escherichia coli M718]
 gi|331053258|gb|EGI25291.1| DNA polymerase III, beta subunit [Escherichia coli TA206]
 gi|331057861|gb|EGI29847.1| DNA polymerase III, beta subunit [Escherichia coli TA143]
 gi|331062607|gb|EGI34527.1| DNA polymerase III, beta subunit [Escherichia coli TA271]
 gi|331067636|gb|EGI39038.1| DNA polymerase III, beta subunit [Escherichia coli TA280]
 gi|331072971|gb|EGI44296.1| DNA polymerase III, beta subunit [Escherichia coli H591]
 gi|331077796|gb|EGI49008.1| DNA polymerase III, beta subunit [Escherichia coli H299]
 gi|332084052|gb|EGI89259.1| DNA polymerase III, beta subunit [Shigella dysenteriae 155-74]
 gi|332084891|gb|EGI90074.1| DNA polymerase III, beta subunit [Shigella boydii 5216-82]
 gi|332089554|gb|EGI94658.1| DNA polymerase III, beta subunit [Shigella boydii 3594-74]
 gi|332104864|gb|EGJ08210.1| DNA polymerase III subunit beta [Shigella sp. D9]
 gi|332345692|gb|AEE59026.1| DNA polymerase III, beta subunit DnaN [Escherichia coli UMNK88]
          Length = 366

 Score =  223 bits (568), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 132/386 (34%), Positives = 217/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +   
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALV 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E E    + +  G S F L + P ++FP
Sbjct: 61  QPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGE---RMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E++R+L   D+ ++V +  + I  ++     + 
Sbjct: 176 RLAVCSMPI-GQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y+   M+I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVTYSGAEMEIGFNVSYVLDVLNALKC-----ENVRMMLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       +A YV+MPMR+
Sbjct: 350 --EDAASQ-------SAAYVVMPMRL 366


>gi|284923784|emb|CBG36882.1| DNA polymerase III beta-subunit [Escherichia coli 042]
          Length = 366

 Score =  223 bits (567), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 132/386 (34%), Positives = 217/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +   
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALV 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E E    + +  G S F L + P ++FP
Sbjct: 61  QSHEPGATTVPARKFFDICRGLPEGAEIAVQLEGE---RMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E++R+L   D+ ++V +  + I  ++     + 
Sbjct: 176 RLAVCSMPI-GQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y+   M+I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVTYSGAEMEIGFNVSYVLDVLNALKC-----ENVRMMLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       +A YV+MPMR+
Sbjct: 350 --EDAASQ-------SAAYVVMPMRL 366


>gi|293464025|ref|ZP_06664439.1| DNA polymerase III [Escherichia coli B088]
 gi|300815052|ref|ZP_07095277.1| DNA polymerase III, beta subunit [Escherichia coli MS 107-1]
 gi|291321657|gb|EFE61093.1| DNA polymerase III [Escherichia coli B088]
 gi|300531944|gb|EFK53006.1| DNA polymerase III, beta subunit [Escherichia coli MS 107-1]
 gi|323944173|gb|EGB40253.1| DNA polymerase III [Escherichia coli H120]
          Length = 366

 Score =  223 bits (567), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 132/386 (34%), Positives = 217/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +   
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALV 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E E    + +  G S F L + P ++FP
Sbjct: 61  QQHEPGATTVPARKFFDICRGLPEGAEIAVQLEGE---RMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E++R+L   D+ ++V +  + I  ++     + 
Sbjct: 176 RLAVCSMPI-GQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y+   M+I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVTYSGAEMEIGFNVSYVLDVLNALKC-----ENVRMMLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       +A YV+MPMR+
Sbjct: 350 --EDAASQ-------SAAYVVMPMRL 366


>gi|290473096|ref|YP_003465957.1| DNA polymerase III subunit beta [Xenorhabdus bovienii SS-2004]
 gi|289172390|emb|CBJ79157.1| DNA polymerase III, beta-subunit [Xenorhabdus bovienii SS-2004]
          Length = 366

 Score =  223 bits (567), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 131/387 (33%), Positives = 215/387 (55%), Gaps = 23/387 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK  +ER  +L+ L      +  + T+P+  ++LLQ  +  L +  +  E+E+   +   
Sbjct: 1   MKFIIEREQLLKPLQQVSSPLGGRPTLPILGNLLLQVTESSLLLTGTDLEMEMKARVALT 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEF 118
                G+ T+ A   +DI R L DGA+IS     EL G  + +  G S F L + P S+F
Sbjct: 61  QPHEQGATTIPARKFFDIWRGLPDGAEISV----ELDGDRILVRSGRSRFSLSTLPASDF 116

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P+  + +    F L  + LK L+E T F+MA +++RYYLNG+ F   EE+L+   VATDG
Sbjct: 117 PNLDDWQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEEEELR--TVATDG 174

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLAV  ++I  Q     S+IVPRK V E++R+L   DS +++ +  + I  ++     +
Sbjct: 175 HRLAVCSMNI-GQNLPSHSVIVPRKGVIELMRLLDGGDSLLQLQIGSNNIRAHVGDFIFT 233

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +L+DG FP+Y+ V+P + DK L  NC  L+QA  R +I+S+ + + V++ LS ++L +T
Sbjct: 234 SKLVDGRFPDYRRVLPKNPDKTLEANCDVLKQAFSRAAILSNEKFRGVRIYLSENQLRIT 293

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
            +NP+  +A E ++V Y    M+I FN  Y+L++++ +       ++V   L  + SSV 
Sbjct: 294 ANNPEQEEAEEIVDVSYQGTEMEIGFNVSYVLDVLNALKC-----EQVSLLLTDATSSVK 348

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           I      +         A YV+MPMR+
Sbjct: 349 IENSASQA---------ATYVVMPMRL 366


>gi|193069140|ref|ZP_03050097.1| DNA polymerase III, beta subunit [Escherichia coli E110019]
 gi|192957464|gb|EDV87910.1| DNA polymerase III, beta subunit [Escherichia coli E110019]
          Length = 366

 Score =  223 bits (567), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 132/386 (34%), Positives = 218/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +   
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALV 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E   G  + +  G S F L + P ++FP
Sbjct: 61  QPHEPGATTVPARKFFDICRGLPEGAEIAVQLE---GERMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I +Q     S+IVPRK V E++R+L   D+ ++V +  + I  ++     + 
Sbjct: 176 RLAVCSMPI-SQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y+   M+I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVTYSGAEMEIGFNVSYVLDVLNALKC-----ENVRMMLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       +A YV+MPMR+
Sbjct: 350 --EDAASQ-------SAAYVVMPMRL 366


>gi|300721091|ref|YP_003710359.1| DNA polymerase III subunit beta [Xenorhabdus nematophila ATCC
           19061]
 gi|297627576|emb|CBJ88095.1| DNA polymerase III, beta-subunit [Xenorhabdus nematophila ATCC
           19061]
          Length = 366

 Score =  223 bits (567), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 130/387 (33%), Positives = 214/387 (55%), Gaps = 23/387 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK  +ER  +L+ L      +  + T+P+  ++LLQ  +G L +  +  E E+   +   
Sbjct: 1   MKFIIEREQLLKPLQQVSSPLSGRPTLPILGNLLLQVTEGSLLLTGTDLETEMKARVTLT 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEF 118
                G+ T+ A   +DI R L DGA+IS     EL G  + +  G S F L + P S+F
Sbjct: 61  QPHEQGATTIPARKFFDIWRGLPDGAEISV----ELDGDRILVRSGRSRFSLSTLPASDF 116

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P+  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDG
Sbjct: 117 PNLDDWQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDG 174

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLAV  ++I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     +
Sbjct: 175 HRLAVCSMNI-GQNLPSHSVIVPRKGVIELMRLLDGGDNPLQLQIGSNNIRAHVGDFIFT 233

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +L+DG FP+Y+ V+P + DK L  NC  L+QA  R +I+S+ + + V++ LS ++L +T
Sbjct: 234 SKLVDGRFPDYRRVLPKNPDKTLEANCDMLKQAFSRAAILSNEKFRGVRIYLSENQLRIT 293

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
            +NP+  +A E ++V Y    M+I FN  Y+L++++ +       ++V   L  + SSV 
Sbjct: 294 ANNPEQEEAEEIVDVSYQGTEMEIGFNVSYVLDVLNALKC-----EQVSLLLTDATSSVK 348

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           I      +         A YV+MPMR+
Sbjct: 349 IENSASQA---------ATYVVMPMRL 366


>gi|89092265|ref|ZP_01165219.1| DNA polymerase III subunit beta [Oceanospirillum sp. MED92]
 gi|89083353|gb|EAR62571.1| DNA polymerase III subunit beta [Oceanospirillum sp. MED92]
          Length = 367

 Score =  223 bits (567), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 128/389 (32%), Positives = 216/389 (55%), Gaps = 26/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAI--- 57
           MK  + R  +++ L     ++ER+ T+PV  ++LL A    L +  +  E+E+ G +   
Sbjct: 1   MKFVISREALIKPLQLVAGVVERRQTLPVLSNILLVAEGDQLSMTGTDLEVELVGRVTLD 60

Query: 58  -PASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPES 116
            PA     GS+TV A  L DI + L D A+I        G ++ I  G S F L + P +
Sbjct: 61  EPAE---AGSVTVPARKLMDICKSLPDSARIEL---TLTGQKMVIKAGRSRFTLSTLPAA 114

Query: 117 EFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVAT 176
           EFP+ ++        +    L+NL+++T F+MA +++RYYLNG+   I    L+  +V+T
Sbjct: 115 EFPNVEDSPETLELSMVQHQLRNLIDKTGFSMAQQDVRYYLNGMLLEIANGQLR--SVST 172

Query: 177 DGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLS 236
           DGHRLA +  D+ A+      IIVPRK + E+ R+L + +  +++ +  S I  ++   +
Sbjct: 173 DGHRLATSVTDVEAEDGMQHQIIVPRKGILELARLLQNGEEELRLVIGASHIRAHVGDFT 232

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
            + +L+DG+FP+Y+ VIP + DK L  +   LRQ + R++I+S+ + + V+LSLSS  L 
Sbjct: 233 FTSKLVDGKFPDYERVIPKNGDKILLSDRMELRQVLSRIAILSNEKYRGVRLSLSSGYLQ 292

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           +  +NP+  +A E++ V Y    +++ FN  YLL+ +  ++S     D V   L  SNSS
Sbjct: 293 VMANNPEQEEAEETLAVDYEGETLEVGFNVNYLLDCLSILNS-----DVVRLTLSDSNSS 347

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             + G D++          + YV+MPMR+
Sbjct: 348 ALVEGFDEE---------GSVYVVMPMRM 367


>gi|324111598|gb|EGC05579.1| DNA polymerase III [Escherichia fergusonii B253]
          Length = 366

 Score =  223 bits (567), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 132/386 (34%), Positives = 217/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +   
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALV 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E E    + +  G S F L + P ++FP
Sbjct: 61  HPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGE---RMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E++R+L   D+ ++V +  + I  ++     + 
Sbjct: 176 RLAVCSMPI-GQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y+   M+I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVTYSGAEMEIGFNVSYVLDVLNALKC-----ENVRMMLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       +A YV+MPMR+
Sbjct: 350 --EDAASQ-------SAAYVVMPMRL 366


>gi|254225545|ref|ZP_04919154.1| DNA polymerase III, beta chain [Vibrio cholerae V51]
 gi|125621865|gb|EAZ50190.1| DNA polymerase III, beta chain [Vibrio cholerae V51]
          Length = 366

 Score =  223 bits (567), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 121/386 (31%), Positives = 218/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ERS +++ L      +  + ++P+  ++LL+  +  L + A+  E+E+   +   
Sbjct: 1   MKFTIERSHLIKPLQQVSGTLGGRASLPILGNLLLKVEENQLSMTATDLEVELISRVTLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   GSITV A    DI R L D A I+   E   G  + +  G S F L + P S+FP
Sbjct: 61  GEFEAGSITVPARKFLDICRGLPDSAVITVLLE---GDRIQVRSGRSRFSLATLPASDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +      L  + L+ L+E+T F+MA +++RYYLNG+ F I+   L+  +VATDGH
Sbjct: 118 NIEDWQSEVQVSLTQAELRGLIEKTQFSMANQDVRYYLNGMLFEIDGTTLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AVA+  + A  A+   IIVPRK V E++++L + +  V + +  S +   +     + 
Sbjct: 176 RMAVAQAQLGADFAQ-KQIIVPRKGVLELVKLLDAPEQPVVLQIGHSNLRAEVNHFVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P   +K L+  C  LRQA  R +I+S+ + + V+++L+ +++ +T 
Sbjct: 235 KLVDGRFPDYRRVLPQHTNKTLQAGCEELRQAFSRAAILSNEKFRGVRVNLADNEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V +   P++I FN  Y+L++++ +       + V   +  +N+S  +
Sbjct: 295 NNPEQEEAEELLDVSFEGEPIEIGFNVSYILDVLNTLRC-----ENVRVSMSDANASALV 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              D DS         A YV+MP+R+
Sbjct: 350 ENVDDDS---------AMYVVMPIRL 366


>gi|215489041|ref|YP_002331472.1| DNA polymerase III subunit beta [Escherichia coli O127:H6 str.
           E2348/69]
 gi|312967889|ref|ZP_07782101.1| DNA polymerase III, beta subunit [Escherichia coli 2362-75]
 gi|215267113|emb|CAS11560.1| DNA polymerase III, beta subunit [Escherichia coli O127:H6 str.
           E2348/69]
 gi|312287450|gb|EFR15358.1| DNA polymerase III, beta subunit [Escherichia coli 2362-75]
          Length = 366

 Score =  223 bits (567), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 132/386 (34%), Positives = 217/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +   
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALV 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E E    + +  G S F L + P ++FP
Sbjct: 61  QPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGE---RMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E++R+L   D+ ++V +  + I  ++     + 
Sbjct: 176 RLAVCSMPI-GQSLPSHSVIVPRKGVIELMRMLDGGDNPMRVQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y+   M+I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVTYSGAEMEIGFNVSYVLDVLNALKC-----ENVRMMLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       +A YV+MPMR+
Sbjct: 350 --EDAASQ-------SAAYVVMPMRL 366


>gi|261346741|ref|ZP_05974385.1| DNA polymerase III, beta subunit [Providencia rustigianii DSM 4541]
 gi|282565141|gb|EFB70676.1| DNA polymerase III, beta subunit [Providencia rustigianii DSM 4541]
          Length = 366

 Score =  223 bits (567), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 124/386 (32%), Positives = 222/386 (57%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  +ER  +L+ L      +  + T+P+  ++LLQ  +G L++  +  E+E+   +P +
Sbjct: 1   MKFIIEREQLLKPLQQVSGPLGGRPTLPILGNLLLQVKEGALQLTGTDLEMEMMANVPLT 60

Query: 61  VD-VCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   G+ TV A   +DI R L +G++I     ++    + +  G S F L + P ++FP
Sbjct: 61  REHEVGATTVPARKFFDIWRGLPEGSEIQVELNDD---RLLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  S+LK L+E T F+MA +++RYYLNG+ F    + L+   V+TDGH
Sbjct: 118 NLDDWQSEVEFSLPQSILKRLIEATQFSMAHQDVRYYLNGMLFETEGQLLR--TVSTDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  +DI  ++    S+IVPRK V E++R+L   D+ +++ +  + I  ++     + 
Sbjct: 176 RLAVCSMDIGQELPSH-SVIVPRKGVIELMRLLDGGDAPLQLQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L  S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLEARCDLLKQAFSRAAILSNEKFRGVRLFFSENQLRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ + S+ V     +F  D+ +S   +
Sbjct: 295 NNPEQEEAEEIVDVSYQGGEMEIGFNVSYILDVLNTLKSENV----TLFLTDAVSS---V 347

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +D  S+       +A YV+MPMR+
Sbjct: 348 QIEDSASR-------SAVYVVMPMRL 366


>gi|77358984|ref|YP_338559.1| DNA polymerase III subunit beta [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76873895|emb|CAI85116.1| DNA polymerase III, beta-subunit; processivity clamp of DNA
           polymerase III [Pseudoalteromonas haloplanktis TAC125]
          Length = 367

 Score =  223 bits (567), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 128/387 (33%), Positives = 220/387 (56%), Gaps = 22/387 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+IT+ R   L+ L      IERK+T+P+  +VLL   +G L +  +  EIE+  ++   
Sbjct: 1   MQITISRQQFLKPLVQVSGAIERKHTLPILSNVLLAVENGQLSMTGTDLEIELVASVFVG 60

Query: 61  VDVCGS-ITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESEF 118
            D+  + +T+ A  L DI + L DG+ ++   +E++L     ++ G S F L +    +F
Sbjct: 61  DDIADTKLTLPAKKLLDICKSLPDGSDLTLSLQEHQL----LLTSGKSRFSLTTLAAEDF 116

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P+ ++ +    F+L    L+ L+E THF+MA +++RYYLNG+ F ++  D+K   VATDG
Sbjct: 117 PNLEQWDGEVEFQLTRLELRKLLESTHFSMANQDVRYYLNGMSFEVDNTDIK--TVATDG 174

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA+A+  +   +     +I+PRK V EI+R++ + +  V +    + I +     + +
Sbjct: 175 HRLAIAQKQLKQSLNTQRQLIIPRKGVQEIMRLMVADEELVTIQFGANHIRIIDIEFTFT 234

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +L+DG FP+Y+ V+P   DK +  N   LR A  RVSI+S+ + + V+L+LS+  L +T
Sbjct: 235 SKLVDGRFPDYRRVLPRGGDKVITANREWLRSAFQRVSILSNEKFRGVRLNLSNGLLKIT 294

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
            +NP+  +A E + V Y    ++I FN  Y+L++++ + +     ++V+F L  SNSS  
Sbjct: 295 ANNPEQEQAEEVVEVGYEGADLEIGFNVSYVLDVLNTLKT-----EDVLFTLADSNSSAL 349

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           I G   +          A YV+MPMR+
Sbjct: 350 IEGAGDEE---------AMYVVMPMRL 367


>gi|332304388|ref|YP_004432239.1| DNA polymerase III, beta subunit [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332171717|gb|AEE20971.1| DNA polymerase III, beta subunit [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 367

 Score =  223 bits (567), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 126/386 (32%), Positives = 222/386 (57%), Gaps = 20/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK ++ R + L+ L      +ER++T+P+  +VL++ +D  L +  +  E+E+   +  +
Sbjct: 1   MKFSISRENFLQPLQLVSGAVERRHTLPILSNVLIKVSDNALWLTGTDLEVELISNVTLT 60

Query: 61  VDVC-GSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            ++  G ITV A  L DI+R L +G++ISF  +   G++  I  G S + L +   +++P
Sbjct: 61  GELEEGEITVPAKKLLDIIRGLAEGSEISFHID---GSKAIIRCGRSKYSLSTLSATDYP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +    FE++ S LK L++  HF+MA +++RYYLNG+   +  ED  +  VATDGH
Sbjct: 118 NLEDWQGELEFEISQSNLKRLIDSVHFSMAQQDVRYYLNGM--SLETEDNVIRTVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA+  ++          +I+PRK V EI R++   D S+KV +  + I +       + 
Sbjct: 176 RLALCRLNYTDATLPNRQVIIPRKGVMEITRLIEDSDKSLKVQVGSNHIRIFSNDFIFTS 235

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P   DK +  +   L+ A  R SI+S+ + + V+L+LSS ++ +T 
Sbjct: 236 KLVDGRFPDYRRVLPKDGDKNIIASKLGLKNAFSRASILSNEKFKGVRLNLSSGEVKITA 295

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A+E ++V Y    ++I FN  YL+++++ +++     +EV F L  SNSS  I
Sbjct: 296 NNPEQEEAVEIVDVDYQGDDLEIGFNVAYLIDVLNALNA-----EEVKFTLADSNSSALI 350

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
                DS         A YV+MPMR+
Sbjct: 351 EDGSDDS---------ALYVIMPMRL 367


>gi|261250638|ref|ZP_05943213.1| DNA polymerase III beta subunit [Vibrio orientalis CIP 102891]
 gi|260939207|gb|EEX95194.1| DNA polymerase III beta subunit [Vibrio orientalis CIP 102891]
          Length = 366

 Score =  223 bits (567), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 124/386 (32%), Positives = 217/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK ++ERS +L+ L      +  + T+P+  ++LL+  D +L + A+  E+E+   +   
Sbjct: 1   MKFSIERSHLLKPLQQVSGALGGRPTLPILGNLLLKVEDNVLSMTATDLEVELISRVTLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   GSITV +    DI R L D + I+F  E   G  V +  G S F L + P ++FP
Sbjct: 61  GEFEAGSITVPSRKFLDICRGLPDDSVITFVLE---GDRVQVRSGRSRFSLSTLPANDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +      L  + L+ LVE+T F+MA +++RYYLNG+ F I  E   L +VATDGH
Sbjct: 118 NIEDWQSEVEVSLTQAELRGLVEKTQFSMANQDVRYYLNGMLFEI--EGTTLRSVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AV++  + A  A+   IIVPRK V E++++L + +  V + +  S +   + +   + 
Sbjct: 176 RMAVSQTQLGADFAQ-KQIIVPRKGVLELVKLLDAPEQPVVLQIGSSNVRAEVNNYVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P S  K L   C  LRQA  R +I+S+ + + V+++L+  ++ +T 
Sbjct: 235 KLVDGRFPDYRRVMPQSTSKTLETGCDELRQAFSRAAILSNEKFRGVRVNLADTEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V +   P++I FN  Y+L++++ +       + V   +  +N+S  I
Sbjct: 295 NNPEQEEAEEMLDVSFEGEPIEIGFNVSYVLDVLNTLRC-----ETVRISMSDANASALI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
                DS         A YV+MP+R+
Sbjct: 350 ENAADDS---------AMYVVMPIRL 366


>gi|294638326|ref|ZP_06716579.1| DNA polymerase III, beta subunit [Edwardsiella tarda ATCC 23685]
 gi|291088579|gb|EFE21140.1| DNA polymerase III, beta subunit [Edwardsiella tarda ATCC 23685]
          Length = 366

 Score =  222 bits (566), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 130/386 (33%), Positives = 216/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  VER  +++ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +P S
Sbjct: 1   MKFIVEREHLIKPLQQVSSPLGGRPTLPILGNLLLQVEDGHLSLTGTDLEMEMVARVPLS 60

Query: 61  -VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A    DI R L DGA+IS   +   G  + +  G S F L + P ++FP
Sbjct: 61  QPHEAGATTVPARKFLDICRGLPDGAEISVALD---GDRMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATLKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E++R+L   ++ +++ +  + +  ++     + 
Sbjct: 176 RLAVCSMPI-GQSLPHHSVIVPRKGVIELMRLLDGGETPLRLQIGSNNLRAHVGGFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLEAGCDELKQAFARAAILSNEKFRGVRLHVSHNQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    ++I FN  Y+L++++ +       + VV  L  + SSV I
Sbjct: 295 NNPEQEEAEELLDVNYPGSDLEIGFNVSYVLDVLNALKC-----ERVVMMLTDAVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+        A YV+MPMR+
Sbjct: 350 --EDAASQ-------AAVYVVMPMRL 366


>gi|238750288|ref|ZP_04611790.1| DNA polymerase III subunit beta [Yersinia rohdei ATCC 43380]
 gi|238711521|gb|EEQ03737.1| DNA polymerase III subunit beta [Yersinia rohdei ATCC 43380]
          Length = 366

 Score =  222 bits (566), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 130/386 (33%), Positives = 220/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  +ER  +L+ L      +  + T+P+  ++LLQ  +G L +  +  E+E+   +  S
Sbjct: 1   MKFIIEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVTEGSLLLTGTDLEMEMVARVALS 60

Query: 61  -VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   +   G  + +  G S F L + P ++FP
Sbjct: 61  QPHEQGATTVPARKFFDIWRGLPEGAEITVALD---GDRLLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + 
Sbjct: 176 RLAVCSMPI-GQTLPSHSVIVPRKGVMELVRLLDGGDTPLRLQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L+ +C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLKASCDLLKQAFARAAILSNEKFRGVRLYVSQNQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y+   M+I FN  Y+L++++ +       +EV   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVSYDGAEMEIGFNVSYVLDVLNALKC-----EEVSLLLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D +S+        A YV+MPMR+
Sbjct: 350 --EDGNSQ-------AAAYVVMPMRL 366


>gi|170766918|ref|ZP_02901371.1| DNA polymerase III, beta subunit [Escherichia albertii TW07627]
 gi|170124356|gb|EDS93287.1| DNA polymerase III, beta subunit [Escherichia albertii TW07627]
          Length = 366

 Score =  222 bits (566), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 132/386 (34%), Positives = 217/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPA- 59
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +   
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALI 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E E    + +  G S F L + P ++FP
Sbjct: 61  QPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGE---RMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E++R+L   D+ ++V +  + I  ++     + 
Sbjct: 176 RLAVCSMPI-GQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y+   M+I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVTYSGAEMEIGFNVSYVLDVLNALKC-----ENVRMMLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       +A YV+MPMR+
Sbjct: 350 --EDAASQ-------SAAYVVMPMRL 366


>gi|300719140|ref|YP_003743943.1| DNA polymerase III subunit beta [Erwinia billingiae Eb661]
 gi|299064976|emb|CAX62096.1| DNA polymerase III subunit beta [Erwinia billingiae Eb661]
          Length = 366

 Score =  222 bits (566), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 128/386 (33%), Positives = 219/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  VER  +L+ L      +  + T+P+  ++LLQ N+G L +  +  E+E+   +  +
Sbjct: 1   MKFIVEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVNEGSLLLTGTDLEMEMVARVALT 60

Query: 61  VD-VCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   G+ TV A   +DI R L +GA+I+   + E    + +  G S F L + P S+FP
Sbjct: 61  QEHEPGATTVPARKFFDICRGLPEGAEITVMLDGE---RMLVRSGRSRFSLSTLPASDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  +      F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWTSEVEFTLPQATLKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + +  Q+    S+IVPRK V E++R+L   D+ ++V +  + I  ++     + 
Sbjct: 176 RLAVCSMPVGQQLPSH-SVIVPRKGVIELVRLLDGGDTPLQVQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLDAGCDILKQAFARAAILSNEKFRGVRLYVSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ +  + V       RL  ++S   +
Sbjct: 295 NNPEQEEAEEMLDVTYGGTDMEIGFNVSYVLDVLNALKCENV-------RLLLTDSVSSV 347

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +D  S+       +A YV+MPMR+
Sbjct: 348 QIEDAASQ-------SAAYVVMPMRL 366


>gi|188535561|ref|YP_001909358.1| DNA polymerase III subunit beta [Erwinia tasmaniensis Et1/99]
 gi|188030603|emb|CAO98498.1| DNA polymerase III subunit beta [Erwinia tasmaniensis Et1/99]
          Length = 366

 Score =  222 bits (566), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 129/386 (33%), Positives = 220/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK TVER  +L+ L      +  + T+P+  ++LLQ  +G L +  +  E+E+   +  +
Sbjct: 1   MKFTVERELLLKPLQQVSSPLGGRPTLPILGNLLLQVTEGTLLLTGTDLEMEMVARVALT 60

Query: 61  VD-VCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D   G+ TV A   +DI R L +GA+I+   E E    + +  G S F L + P S+FP
Sbjct: 61  QDHEPGATTVPARKFFDICRGLPEGAEIAVILEGE---RMLVRSGRSRFSLSTLPASDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F    ++L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGDELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  +  V Q     S+IVPRK V E++R+L   DS ++V +  + I  ++     + 
Sbjct: 176 RLAVCSMP-VGQSLPSHSVIVPRKGVIELVRLLDGGDSLLQVQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L  +C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLDASCDLLKQAFSRAAILSNEKFRGVRLYVSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    ++I FN  Y+L++++ +  + V       RL  ++S   +
Sbjct: 295 NNPEQEEAEEMLDVTYGGTDLEIGFNVSYVLDVLNALKCENV-------RLLLTDSVSSV 347

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +D  S+       +A YV+MPMR+
Sbjct: 348 QIEDAASQ-------SAAYVVMPMRL 366


>gi|153212930|ref|ZP_01948524.1| DNA polymerase III, beta chain [Vibrio cholerae 1587]
 gi|229520185|ref|ZP_04409612.1| DNA polymerase III beta subunit [Vibrio cholerae TM 11079-80]
 gi|254291126|ref|ZP_04961923.1| DNA polymerase III, beta chain [Vibrio cholerae AM-19226]
 gi|124116156|gb|EAY34976.1| DNA polymerase III, beta chain [Vibrio cholerae 1587]
 gi|150422971|gb|EDN14921.1| DNA polymerase III, beta chain [Vibrio cholerae AM-19226]
 gi|229342779|gb|EEO07770.1| DNA polymerase III beta subunit [Vibrio cholerae TM 11079-80]
          Length = 366

 Score =  222 bits (566), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 121/386 (31%), Positives = 217/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ERS +++ L      +  + ++P+  ++LL+  +  L + A+  E+E+   +   
Sbjct: 1   MKFTIERSHLIKPLQQVSGTLGGRASLPILGNLLLKVEENQLSMTATDLEVELISRVTLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   GSITV A    DI R L D A I+   E   G  + +  G S F L + P ++FP
Sbjct: 61  GEFEAGSITVPARKFLDICRGLPDSAVITVLLE---GDRIQVRSGRSRFSLATLPANDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +      L  + L+ L+E+T F+MA +++RYYLNG+ F I+   L+  +VATDGH
Sbjct: 118 NIEDWQSEVQVSLTQAELRGLIEKTQFSMANQDVRYYLNGMLFEIDGTTLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AVA+  + A  A+   IIVPRK V E++++L + +  V + +  S +   +     + 
Sbjct: 176 RMAVAQAQLGADFAQ-KQIIVPRKGVLELVKLLDAPEQPVVLQIGHSNLRAEVNHFVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P    K L+  C  LRQA  R +I+S+ + + V+++L+ +++ +T 
Sbjct: 235 KLVDGRFPDYRRVLPQHTSKTLQAGCEELRQAFSRAAILSNEKFRGVRVNLADNEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V +   P++I FN  Y+L++++ +       D V   +  +N+S  +
Sbjct: 295 NNPEQEEAEELLDVSFEGEPIEIGFNVSYILDVLNTLRC-----DNVRVSMSDANASALV 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              D DS         A YV+MP+R+
Sbjct: 350 ENVDDDS---------AMYVVMPIRL 366


>gi|260771048|ref|ZP_05879976.1| DNA polymerase III beta subunit [Vibrio furnissii CIP 102972]
 gi|260613937|gb|EEX39128.1| DNA polymerase III beta subunit [Vibrio furnissii CIP 102972]
          Length = 366

 Score =  222 bits (566), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 123/386 (31%), Positives = 215/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ERS  ++ L      +  + T+P+  ++LL+  D  L + A+  E+E+   +   
Sbjct: 1   MKFTIERSHFIKPLQQVSGTLGGRATLPILGNLLLKVEDNQLSMTATDLEVELVSRVTLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D   G+ TV A    DI R L D A I+   E   G  V +  G S F L + P S+FP
Sbjct: 61  GDFEAGTTTVPARKFLDICRGLPDAAVITVVLE---GDRVQVRSGRSRFSLATLPASDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +      L    L+ LVE+T F+MA +++RYYLNG+ F I+   L+  +VATDGH
Sbjct: 118 NIEDWQSEVELSLTQGELRGLVEKTQFSMANQDVRYYLNGMLFEIDGSTLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AV++ ++ A  A    IIVPRK V E++++L + +  V + +  S +   + +   + 
Sbjct: 176 RMAVSQTELGADFAN-KQIIVPRKGVLELVKLLDAPEQPVVLQIGSSNLRAEVNNFVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + +K L+  C  LRQA  R +I+S+ + + V+++L   ++ +T 
Sbjct: 235 KLVDGRFPDYRRVLPQNTNKTLQAGCDELRQAFSRAAILSNEKFRGVRVNLDGGEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V ++   ++I FN  Y+L++++ +       + V   +  +N+S  I
Sbjct: 295 NNPEQEEAEEMLDVNFDGEAIEIGFNVSYVLDVLNTLRC-----ENVRVSMSDANASALI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              D DS         A YV+MP+R+
Sbjct: 350 ENVDDDS---------AMYVVMPIRL 366


>gi|152994045|ref|YP_001338880.1| DNA polymerase III subunit beta [Marinomonas sp. MWYL1]
 gi|150834969|gb|ABR68945.1| DNA polymerase III, beta subunit [Marinomonas sp. MWYL1]
          Length = 365

 Score =  222 bits (566), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 139/388 (35%), Positives = 218/388 (56%), Gaps = 26/388 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK +V R  +L+ L     ++ERK T+PV  +VL++  D LL +  S  E+E+ G +P  
Sbjct: 1   MKFSVVRETLLKPLQLVAGVVERKQTMPVLANVLVEVKDQLLTLTGSDLEVELVGHVP-- 58

Query: 61  VDVC--GSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEF 118
           +D C  G ITV A  L DI + L D A I F  +++      I  G S F L + P  EF
Sbjct: 59  LDECEEGRITVPARKLMDICKSLPDSAVIEFTLDDQKAV---IRSGRSRFSLSTLPADEF 115

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P+ ++ +   +  +A + ++ L++RT FAMA +++RYYLNG+   +   D +L  VATDG
Sbjct: 116 PNIQDMQGDLTVSIAQNSVRRLIDRTGFAMANQDVRYYLNGMLLEV--ADGQLRVVATDG 173

Query: 179 HRLAVAEVDIVAQIAK-MPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           HRLA A  D  AQ++  +  +IVPRK V E+ R+L+  D  V++++  + I   +     
Sbjct: 174 HRLATAVED--AQVSGDLTQVIVPRKGVLELNRLLNDTDEVVELTIGTNHIRAKVAEYVF 231

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +L+DG+FP+Y  VIP +N+K +  +   LRQ   R SI+S+ + + V+L LS+  L +
Sbjct: 232 TSKLVDGKFPDYHRVIPRNNEKIVIADRLELRQVFLRASILSNEKYRGVRLILSNGMLQV 291

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
             +NP+  +A ES+ V Y    M++ FN  YLL+++  + S      EV   L+ SNSS 
Sbjct: 292 FANNPEQEEAEESVLVQYQGDNMEVGFNVGYLLDVLGVVDS-----QEVRLSLNDSNSSA 346

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            I      +         A YV+MPMR+
Sbjct: 347 LIEEAQSHA---------AQYVVMPMRL 365


>gi|238787827|ref|ZP_04631624.1| DNA polymerase III subunit beta [Yersinia frederiksenii ATCC 33641]
 gi|238724170|gb|EEQ15813.1| DNA polymerase III subunit beta [Yersinia frederiksenii ATCC 33641]
          Length = 366

 Score =  222 bits (566), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 129/386 (33%), Positives = 220/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  +ER  +L+ L      +  + T+P+  ++LLQ  +G L +  +  E+E+   +  S
Sbjct: 1   MKFIIEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVTEGSLLLTGTDLEMEMVARVALS 60

Query: 61  -VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   +   G  + +  G S F L + P ++FP
Sbjct: 61  QPHTQGATTVPARKFFDIWRGLPEGAEITVALD---GDRLLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  +  V Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + 
Sbjct: 176 RLAVCSMP-VGQTLPSHSVIVPRKGVMELVRLLDGGDTPLRLQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L+ +C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLKASCDLLKQAFARAAILSNEKFRGVRLYVSQNQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y+   M+I FN  Y+L++++ +       ++V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVSYDGAEMEIGFNVSYVLDVLNALKC-----EDVSLLLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D +S+        A YV+MPMR+
Sbjct: 350 --EDGNSQ-------AAAYVVMPMRL 366


>gi|242237462|ref|YP_002985643.1| DNA polymerase III subunit beta [Dickeya dadantii Ech703]
 gi|242129519|gb|ACS83821.1| DNA polymerase III, beta subunit [Dickeya dadantii Ech703]
          Length = 366

 Score =  222 bits (565), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 128/386 (33%), Positives = 221/386 (57%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK  VER  +L+ L      +  + T+P+  ++LLQ ++G L +  +  E+E+   +   
Sbjct: 1   MKFIVEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVSEGRLSLTGTDLEMEMVAHVTLT 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A  L+DI R L DGA+I+   E   G  + +  G S F L + P S+FP
Sbjct: 61  QPHEPGATTVPARKLFDICRGLPDGAEITVTLE---GDRMLVRSGRSRFSLSTLPASDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +   +FEL  + LK L+E T F+MA +++RYYLNG+ F  + + L+   VATDGH
Sbjct: 118 NLDDWQSEVAFELPQATLKRLIEATQFSMAHQDVRYYLNGMLFETSGDGLR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  +  V Q     S+IVPRK V E++R+L   ++ +++ +  + I  ++     + 
Sbjct: 176 RLAVCSMP-VGQPLPSHSVIVPRKGVMELVRLLDGGETPLQLQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L  +C  LRQA  R +I+S+ + + V+L L+ ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLEASCDLLRQAFARAAILSNEKFRGVRLYLNQNQLRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ +  ++V       R+  ++ +  +
Sbjct: 295 NNPEQEEAEEILDVEYGGTEMEIGFNVSYVLDVLNALKCEDV-------RMLLADPASSV 347

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +D  S+        A YV+MPMR+
Sbjct: 348 QLEDCASQ-------AAAYVVMPMRL 366


>gi|167041927|gb|ABZ06665.1| putative DNA polymerase III beta subunit, N-terminal domain protein
           [uncultured marine microorganism HF4000_137B17]
          Length = 371

 Score =  222 bits (565), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 128/388 (32%), Positives = 231/388 (59%), Gaps = 20/388 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           M+ T+ R+  L+ L HA  IIE+K T+P+  ++L++A D  + I A+  +I  T  IP  
Sbjct: 1   MEFTISRNTFLKSLSHAYGIIEKKTTLPILSNILIEAKDSKIRITATDLDIIYTEEIPLQ 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   GS T SA ++YDI+RKL+   ++  F ++    ++ +  G+S F L       FP
Sbjct: 61  ELKKEGSTTTSASIIYDILRKLEPNTKVELFLQS--ANKLKLVSGNSKFNLLCLSPDNFP 118

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFH-INEEDLK-LCAVATD 177
              E+    +FE++S+ +  L+ +T  +++ +E R+YLNGI+ H IN E+   L +V+TD
Sbjct: 119 LADEDIKQKTFEISSNKMLKLLNKTKISISNDETRHYLNGIYLHKINIENKSFLSSVSTD 178

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
            HRL+ + ++I +      SII+P+K + +++ +L    S++K+S ++S+I   I++  +
Sbjct: 179 SHRLSSSRLEIDSN-TDFESIILPKKTIFQLISLLEQSTSAIKISNNKSKIKFEIDNGVL 237

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
             ++IDG FP+Y  V+P  N K L++     + +++RV+ +SS R + +K+ +S D L +
Sbjct: 238 ISKVIDGRFPDYSKVVPIDNVKILQIKLNEFKNSIERVTTVSSDRKEGLKMKISKDFLQL 297

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           +V++P+ G+ IES+N  +N   MDI FN +YL++I     + ++ +D ++  L  + S V
Sbjct: 298 SVNSPNSGEGIESINAIFNSDDMDISFNSRYLIDI-----ASQIENDLIIINLKDAASPV 352

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            I  KD   K       N+F+V+MPM+I
Sbjct: 353 LI--KDMSDK-------NSFHVVMPMKI 371


>gi|58579625|ref|YP_198641.1| DNA polymerase III subunit beta [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84621659|ref|YP_449031.1| DNA polymerase III subunit beta [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188574272|ref|YP_001911201.1| DNA polymerase III subunit beta [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|58424219|gb|AAW73256.1| DNA polymerase III beta chain [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84365599|dbj|BAE66757.1| DNA polymerase III beta chain [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188518724|gb|ACD56669.1| DNA polymerase III, beta subunit [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 366

 Score =  222 bits (565), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 127/385 (32%), Positives = 219/385 (56%), Gaps = 19/385 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ T++R   L+ L     ++ER+ T+PV  ++L+Q  DG + +  +  E+E+     A 
Sbjct: 1   MRFTLQREAFLKPLAQVVNVVERRQTLPVLANLLVQVKDGQVSLTGTDLEVEMIARTMAE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               G  T+ A  L+DI+R L DG++++    ++ G +V +  G S F L + P ++FPS
Sbjct: 61  DVQDGETTIPARKLFDILRALPDGSRVTI---SQTGDKVTVQAGRSRFTLATLPANDFPS 117

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
             E E      +  + LK L+ERT FAMA +++RYYLNG+ F + +  L+ C VATDGHR
Sbjct: 118 VDEVEATERVVVPEAGLKELIERTAFAMAQQDVRYYLNGLLFDLRDGLLR-C-VATDGHR 175

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LA+ E+++         IIVPRK V E+LR+L   D  V++ +  S I +    ++ + +
Sbjct: 176 LALCEMELENAGGAKRQIIVPRKGVTELLRLLEGADREVELEVGRSHIRVKRGDVTFTSK 235

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDG FP+Y+ VIP   D+E++V+   LR ++ R +I+S+ + + V++ +S  +L ++  
Sbjct: 236 LIDGRFPDYEAVIPIGADREVKVDREALRASLQRAAILSNEKYRGVRVEVSPGQLKISAH 295

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           NP+  +A E +        + I FN  YLL+ +  +      D+ VV +L  +NSS  +R
Sbjct: 296 NPEQEEAQEEIEADTKVDDLAIGFNVNYLLDALSALR-----DEHVVIQLRDANSSALVR 350

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
             +  S+ ++       +V+MP+R+
Sbjct: 351 --EASSEKSR-------HVVMPLRL 366


>gi|254507273|ref|ZP_05119409.1| DNA polymerase III, beta subunit [Vibrio parahaemolyticus 16]
 gi|219549733|gb|EED26722.1| DNA polymerase III, beta subunit [Vibrio parahaemolyticus 16]
          Length = 366

 Score =  222 bits (565), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 120/386 (31%), Positives = 219/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK ++ERS +L+ L      +  + T+P+  ++LL+  D +L + A+  E+E+   +   
Sbjct: 1   MKFSIERSHLLKPLQQVSGALGGRPTLPILGNLLLKVEDNVLSMTATDLEVELISRVTLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D   GSITV +    DI R L D + I+F  E   G  V +  G S F L + P ++FP
Sbjct: 61  GDFEAGSITVPSRKFLDICRGLPDDSVITFVLE---GDRVQVRSGRSRFSLATLPANDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +      L  + L+ L+E+T F+MA +++RYYLNG+ F I    L+  +VATDGH
Sbjct: 118 NIEDWQSEVEISLTQAELRGLIEKTQFSMANQDVRYYLNGMLFEIEGSTLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AV++  + A  A+   IIVPRK V E+++++ + +  V + +  S +   + +   + 
Sbjct: 176 RMAVSQTALGADFAQQ-QIIVPRKGVLELVKLMDAPEQPVTLQIGSSNVRAEVNNFVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P +  K L   C  LR A  R +I+S+ + + V+++L+  ++ +T 
Sbjct: 235 KLVDGRFPDYRRVMPQNTTKTLEAGCDELRSAFSRAAILSNEKFRGVRVNLADTEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V ++  P++I FN  Y+L++++ +       ++V   +  +N+S  I
Sbjct: 295 NNPEQEEAEEMLDVSFDGEPIEIGFNVSYVLDVLNTLRC-----EKVRVSMSDANASALI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              + DS         A YV+MP+R+
Sbjct: 350 ENAEDDS---------AMYVVMPIRL 366


>gi|21326650|gb|AAL30090.1| DNA polymerase III beta chain [Xanthomonas campestris pv.
           campestris]
          Length = 366

 Score =  222 bits (565), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 127/385 (32%), Positives = 219/385 (56%), Gaps = 19/385 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ T++R   L+ L     ++ER+ T+PV  ++L+Q N+G L +  +  E+E+       
Sbjct: 1   MRFTLQREAFLKPLAQVVNVVERRQTLPVLANLLVQVNNGQLSLTGTDLEVEMISRTMVE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               G  T+ A  L+DI+R L DG++++    ++ G +V +  G S F L + P ++FPS
Sbjct: 61  DAQDGETTIPARKLFDILRALPDGSRVTV---SQTGDKVTVQAGRSRFTLATLPANDFPS 117

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
             E E      +  + LK L+ERT FAMA +++RYYLNG+ F + +  L+ C VATDGHR
Sbjct: 118 VDEVEATERVAVPEAGLKELMERTAFAMAQQDVRYYLNGLLFDLRDGLLR-C-VATDGHR 175

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           L + E ++    +    IIVPRK V E+LR+L + D  V++ L  S I +    ++ + +
Sbjct: 176 LPLCETELEKSGSAKRQIIVPRKGVTELLRLLEAADRDVELELGRSHIRVKRGDVTFTSK 235

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDG FP+Y+ VIP   D+E++V+   LR ++ R +I+S+ + + V++ +S  +L ++  
Sbjct: 236 LIDGRFPDYEAVIPIGADREVKVDREALRASLQRAAILSNEKYRGVRVEVSPGQLKISAH 295

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           NP+  +A E +        + I FN  YLL+ +  +      D+ VV +L  +NSS  +R
Sbjct: 296 NPEQEEAQEEIEADTKVDDLAIGFNVNYLLDALSALR-----DEHVVIQLRDANSSALVR 350

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
             +  S+ ++       +V+MP+R+
Sbjct: 351 --EASSEKSR-------HVVMPLRL 366


>gi|304398067|ref|ZP_07379942.1| DNA polymerase III, beta subunit [Pantoea sp. aB]
 gi|304354353|gb|EFM18725.1| DNA polymerase III, beta subunit [Pantoea sp. aB]
          Length = 366

 Score =  222 bits (565), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 132/386 (34%), Positives = 215/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  VER  +L+ L      +  + T+P+  ++LLQ  +G L +  +  E+E+   +  +
Sbjct: 1   MKFIVEREQLLKPLQQVSGPLGGRPTLPILGNLLLQVTEGSLLLTGTDLEMEMVARVALT 60

Query: 61  -VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                GS TV A    DI R L DGA+I+   E   G  + +  G S F L + P S+FP
Sbjct: 61  QAHEPGSTTVPARKFLDICRGLPDGAEITLALE---GDRMLVRSGRSRFSLSTLPASDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATLKRLIEATQFSMAHQDVRYYLNGMMFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E+LR+L   D+ ++V +  S I  ++     + 
Sbjct: 176 RLAVCSMPI-GQALPSHSVIVPRKGVIELLRLLDGGDTPLQVRIGGSNIRAHVGDYIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L ++ ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKVLEAGCDLLKQAFARAAILSNEKFRGVRLYITENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V YN   ++I FN  Y+L++++ +  + V       RL  ++S   +
Sbjct: 295 NNPEQEEAEEMLDVSYNGTELEIGFNVSYVLDVLNALKCENV-------RLLLTDSVSSV 347

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +D  S         A YV+MPMR+
Sbjct: 348 QIEDVASP-------AAAYVVMPMRL 366


>gi|296100373|ref|YP_003610519.1| DNA polymerase III subunit beta [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295054832|gb|ADF59570.1| DNA polymerase III subunit beta [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 366

 Score =  222 bits (565), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 130/386 (33%), Positives = 218/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +  +
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMIARVTLT 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E   G  + +  G S F L + P ++FP
Sbjct: 61  QPHDAGATTVPARKFFDICRGLPEGAEIAVQLE---GDRMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I   +    S+IVPRK V E++R+L   D+ ++V +  + I  ++     + 
Sbjct: 176 RLAVCSMPIGDSLPNH-SVIVPRKGVIELMRMLDGGDTPLRVQIGSNNIRAHVGDFVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C +L+QA  R +I+S+ + + V+L +S +++ +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLEAGCDSLKQAFARAAILSNEKFRGVRLYVSENQIKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVTYAGAEMEIGFNVSYVLDVLNALKC-----ENVRILLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       +A YV+MPMR+
Sbjct: 350 --EDAASQ-------SAAYVVMPMRL 366


>gi|30065009|ref|NP_839180.1| DNA polymerase III subunit beta [Shigella flexneri 2a str. 2457T]
 gi|56480410|ref|NP_709499.2| DNA polymerase III subunit beta [Shigella flexneri 2a str. 301]
 gi|110807609|ref|YP_691129.1| DNA polymerase III subunit beta [Shigella flexneri 5 str. 8401]
 gi|30043270|gb|AAP18991.1| DNA polymerase III, beta-subunit [Shigella flexneri 2a str. 2457T]
 gi|56383961|gb|AAN45206.2| DNA polymerase III, beta-subunit [Shigella flexneri 2a str. 301]
 gi|110617157|gb|ABF05824.1| DNA polymerase III, beta-subunit [Shigella flexneri 5 str. 8401]
 gi|281603072|gb|ADA76056.1| DNA polymerase III, beta-subunit [Shigella flexneri 2002017]
 gi|313647709|gb|EFS12157.1| DNA polymerase III, beta subunit [Shigella flexneri 2a str. 2457T]
 gi|332750522|gb|EGJ80931.1| DNA polymerase III, beta subunit [Shigella flexneri K-671]
 gi|332750693|gb|EGJ81101.1| DNA polymerase III, beta subunit [Shigella flexneri 4343-70]
 gi|332751746|gb|EGJ82144.1| DNA polymerase III, beta subunit [Shigella flexneri 2747-71]
 gi|332764072|gb|EGJ94309.1| DNA polymerase III, beta subunit [Shigella flexneri 2930-71]
 gi|332996041|gb|EGK15668.1| DNA polymerase III, beta subunit [Shigella flexneri VA-6]
 gi|332997108|gb|EGK16724.1| DNA polymerase III, beta subunit [Shigella flexneri K-218]
 gi|333013256|gb|EGK32629.1| DNA polymerase III, beta subunit [Shigella flexneri K-304]
          Length = 366

 Score =  222 bits (565), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 132/386 (34%), Positives = 217/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +   
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALV 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E E    + +  G S F L + P ++FP
Sbjct: 61  QPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGE---RMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E++R+L   D+ ++V +  + I  ++     + 
Sbjct: 176 RLAVCSMPI-GQSLPSHSVIVPRKGVIELMRMLDGGDNLLRVQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y+   M+I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVTYSGAEMEIGFNVSYVLDVLNALKC-----ENVRMMLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       +A YV+MPMR+
Sbjct: 350 --EDAASQ-------SAAYVVMPMRL 366


>gi|109896334|ref|YP_659589.1| DNA polymerase III, beta subunit [Pseudoalteromonas atlantica T6c]
 gi|109698615|gb|ABG38535.1| DNA polymerase III, beta subunit [Pseudoalteromonas atlantica T6c]
          Length = 367

 Score =  222 bits (565), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 125/386 (32%), Positives = 220/386 (56%), Gaps = 20/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK ++ R + L+ L      +ER++T+P+  +VL++ +D  L +  +  E+E+   +  +
Sbjct: 1   MKFSISRENFLQPLQLVSGAVERRHTLPILSNVLIKVSDSALWLTGTDLEVELISNVTLT 60

Query: 61  VDVC-GSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D   G ITV A  L DI+R L +G++ISF  +   G +  +  G S + L +   +++P
Sbjct: 61  GDFEEGEITVPAKKLLDIIRGLTEGSEISFHVD---GNKAILRCGRSKYSLSTLSANDYP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +    FE++ + LK L++  HF+MA +++RYYLNG+   +  ED  +  VATDGH
Sbjct: 118 NLEDWQGELEFEISQANLKRLIDSVHFSMAQQDVRYYLNGM--SLETEDNVIRTVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA+  ++          +I+PRK V EI R++   D S+KV +  + I +       + 
Sbjct: 176 RLALCRLNYTDATLPNRQVIIPRKGVMEITRLIEDSDKSLKVQVGSNHIRIFSNDFIFTS 235

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P   DK +  +   L+ A  R SI+S+ + + V+L+LSS ++ +T 
Sbjct: 236 KLVDGRFPDYRRVLPKDGDKNIIASKLGLKNAFSRASILSNEKFKGVRLNLSSGEVKITA 295

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A+E ++V Y    ++I FN  YL+++++ +++     +EV F L  SNSS  I
Sbjct: 296 NNPEQEEAVEIVDVDYQGGDLEIGFNVAYLIDVLNALNA-----EEVKFTLADSNSSALI 350

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
                DS         A YV+MPMR+
Sbjct: 351 EDGSDDS---------ALYVIMPMRL 367


>gi|311277334|ref|YP_003939565.1| DNA polymerase III, beta subunit [Enterobacter cloacae SCF1]
 gi|308746529|gb|ADO46281.1| DNA polymerase III, beta subunit [Enterobacter cloacae SCF1]
          Length = 366

 Score =  221 bits (564), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 131/386 (33%), Positives = 217/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +   
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGALSLTGTDLEMEMVARVALT 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E   G  + +  G S F L + P ++FP
Sbjct: 61  QPHNAGATTVPARKFFDICRGLPEGAEIAVQLE---GDRMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F +A + +K L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTVAQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I   +    S+IVPRK V E++R+L   D+ ++V +  + I  ++     + 
Sbjct: 176 RLAVCAMPIGETLPNH-SVIVPRKGVIELMRMLDGGDTPLRVQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKHLDAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVTYAGAEMEIGFNVSYVLDVLNALKC-----ENVRILLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       +A YV+MPMR+
Sbjct: 350 --EDAASQ-------SAAYVVMPMRL 366


>gi|293393722|ref|ZP_06638030.1| DNA-directed DNA polymerase III beta subunit [Serratia odorifera
           DSM 4582]
 gi|291423766|gb|EFE96987.1| DNA-directed DNA polymerase III beta subunit [Serratia odorifera
           DSM 4582]
          Length = 366

 Score =  221 bits (564), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 128/386 (33%), Positives = 219/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  VER  +L+ L      +  + T+P+  ++LLQ  +G L +  +  E+E+   +  S
Sbjct: 1   MKFIVEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVTEGSLLLTGTDLEMEMVARVALS 60

Query: 61  -VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   + E    + +  G S F L + P ++FP
Sbjct: 61  QPHEAGATTVPARKFFDICRGLPEGAEITVQLDGE---RMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATLKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q+    S+IVPRK V E++R+L   D+ +++ +  + I  ++     + 
Sbjct: 176 RLAVCAMPIGQQLPSH-SVIVPRKGVMELVRLLDGGDTPLQLQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLEAGCDLLKQAFARAAILSNEKFRGVRLYVSHNQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ +  ++V       RL  ++S   +
Sbjct: 295 NNPEQEEAEEILDVIYEGTEMEIGFNVSYVLDVLNALKCEDV-------RLLLTDSVSSV 347

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +D  SK       +A YV+MPMR+
Sbjct: 348 QIEDGASK-------SAAYVVMPMRL 366


>gi|197262814|ref|ZP_03162888.1| DNA polymerase III, beta subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197241069|gb|EDY23689.1| DNA polymerase III, beta subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
          Length = 366

 Score =  221 bits (564), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 131/386 (33%), Positives = 217/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +  S
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVTLS 60

Query: 61  -VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E   G  + +  G S F L + P ++FP
Sbjct: 61  QPHEPGATTVPARKFFDICRGLPEGAEIAVQLE---GDRMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F     +L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGSELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + + A +    S+IVPRK V E++R+L   ++ ++V +  + I  ++     + 
Sbjct: 176 RLAVCSMPLEASLPSH-SVIVPRKGVIELMRMLDGGENPLRVQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKHLEAGCDILKQAFARAAILSNEKFRGVRLYVSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVSYGGTEMEIGFNVSYVLDVLNALKC-----ETVRIMLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       NA YV+MPMR+
Sbjct: 350 --EDAASQ-------NAAYVVMPMRL 366


>gi|238765485|ref|ZP_04626404.1| DNA polymerase III subunit beta [Yersinia kristensenii ATCC 33638]
 gi|238696309|gb|EEP89107.1| DNA polymerase III subunit beta [Yersinia kristensenii ATCC 33638]
          Length = 366

 Score =  221 bits (564), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 130/386 (33%), Positives = 219/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  +ER  +L+ L      +  + T+P+  ++LLQ  +G L +  +  E+E+   +  S
Sbjct: 1   MKFIIEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVTEGSLLLTGTDLEMEMVARVALS 60

Query: 61  -VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GAQI+   +   G  + +  G S F L + P ++FP
Sbjct: 61  QPHEQGATTVPARKFFDIWRGLPEGAQITVALD---GDRLLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + 
Sbjct: 176 RLAVCAMPI-GQTLPSHSVIVPRKGVMELVRLLDGGDTPLRLQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L+ +C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLKASCDLLKQAFARAAILSNEKFRGVRLYVSQNQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y+   M+I FN  Y+L++++ +       ++V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVSYDGAEMEIGFNVSYVLDVLNALKC-----EDVSLLLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+        A YV+MPMR+
Sbjct: 350 --EDGASQ-------AAAYVVMPMRL 366


>gi|332997867|gb|EGK17475.1| DNA polymerase III, beta subunit [Shigella flexneri K-272]
 gi|333013662|gb|EGK33027.1| DNA polymerase III, beta subunit [Shigella flexneri K-227]
          Length = 366

 Score =  221 bits (564), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 132/386 (34%), Positives = 217/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +   
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALV 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E E    + +  G S F L + P ++FP
Sbjct: 61  HPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGE---RMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E++R+L   D+ ++V +  + I  ++     + 
Sbjct: 176 RLAVCSMPI-GQSLPSHSVIVPRKGVIELMRMLDGGDNLLRVQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y+   M+I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVTYSGAEMEIGFNVSYVLDVLNALKC-----ENVRMMLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       +A YV+MPMR+
Sbjct: 350 --EDAASQ-------SAAYVVMPMRL 366


>gi|325922760|ref|ZP_08184494.1| DNA polymerase III, beta subunit [Xanthomonas gardneri ATCC 19865]
 gi|325546756|gb|EGD17876.1| DNA polymerase III, beta subunit [Xanthomonas gardneri ATCC 19865]
          Length = 366

 Score =  221 bits (563), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 126/385 (32%), Positives = 219/385 (56%), Gaps = 19/385 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ T++R   L+ L     ++ER+ T+PV  ++L+Q  DG + +  +  E+E+       
Sbjct: 1   MRFTLQREAFLKPLAQVVNVVERRQTLPVLANLLVQVKDGQVSLTGTDLEVEMISRTMVE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               G  T+ A  L+DI+R L DG++++    ++ G +V +  G S F L + P ++FPS
Sbjct: 61  DAQDGETTIPARKLFDILRALPDGSRVTI---SQTGDKVTVQAGRSRFTLATLPANDFPS 117

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
             E E      +  + LK L+ERT FAMA +++RYYLNG+ F + +  L+ C VATDGHR
Sbjct: 118 VDEVEATERVVVPEAGLKELIERTAFAMAQQDVRYYLNGLLFDLRDGLLR-C-VATDGHR 175

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LA+ E+++         IIVPRK V E+LR+L + D  V++ +  S I +    ++ + +
Sbjct: 176 LALCEMELEKAGGAKRQIIVPRKGVTELLRLLEAADREVELEVGRSHIRVKRGDVTFTSK 235

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDG FP+Y+ VIP   D+E++V+   LR ++ R +I+S+ + + V++ +S  +L ++  
Sbjct: 236 LIDGRFPDYEAVIPIGADREVKVDREALRASLQRAAILSNEKYRGVRVEVSPGQLKISAH 295

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           NP+  +A E +        + I FN  YLL+ +  +      D+ VV +L  +NSS  +R
Sbjct: 296 NPEQEEAQEEIEADTKVDDLAIGFNVNYLLDALSALR-----DEHVVIQLRDANSSALVR 350

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
             +  S+ ++       +V+MP+R+
Sbjct: 351 --EASSEKSR-------HVVMPLRL 366


>gi|297581953|ref|ZP_06943873.1| DNA polymerase subunit III [Vibrio cholerae RC385]
 gi|297533820|gb|EFH72661.1| DNA polymerase subunit III [Vibrio cholerae RC385]
          Length = 366

 Score =  221 bits (563), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 121/386 (31%), Positives = 216/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ERS +++ L      +  + ++P+  ++LL+  +  L + A+  E+E+   +   
Sbjct: 1   MKFTIERSHLIKPLQQVSGTLGGRASLPILGNLLLKVEENQLSMTATDLEVELISRVTLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   GSITV A    DI R L D A I+   E   G  + +  G S F L + P S+FP
Sbjct: 61  GEFEAGSITVPARKFLDICRGLPDSAVITVLLE---GDRIQVRSGRSRFSLATLPASDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +      L  + L+ L+E+T F+MA +++RYYLNG+ F I+   L+  +VATDGH
Sbjct: 118 NIEDWQSEVQVSLTQAELRGLIEKTQFSMANQDVRYYLNGMLFEIDGTTLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AVA+  + A  A+   IIVPRK   E++++L + +  V + +  S +   +     + 
Sbjct: 176 RMAVAQAQLGADFAQ-KQIIVPRKGGLELVKLLDAPEQPVVLQIGHSNLRAEVNHFVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P    K L+  C  LRQA  R +I+S+ + + V+++L+ +++ +T 
Sbjct: 235 KLVDGRFPDYRRVLPQHTSKTLQAGCEELRQAFSRAAILSNEKFRGVRVNLADNEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V +   P++I FN  Y+L++++ +       D V   +  +N+S  +
Sbjct: 295 NNPEQEEAEELLDVSFEGEPIEIGFNVSYILDVLNTLRC-----DNVRVSMSDANASALV 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              D DS         A YV+MP+R+
Sbjct: 350 ENVDDDS---------AMYVVMPIRL 366


>gi|117619320|ref|YP_854529.1| DNA polymerase III, beta subunit [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117560727|gb|ABK37675.1| DNA polymerase III, beta subunit [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 367

 Score =  221 bits (563), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 130/386 (33%), Positives = 217/386 (56%), Gaps = 20/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++ + R  +L  L      +  + T+P+  +VLL  ++GLL +  +  E+E+ G +  +
Sbjct: 1   MQLEISREALLRPLQLVSGALGGRPTLPILGNVLLDVSNGLLSLTGTDLEVEMIGQVYLN 60

Query: 61  VDVC-GSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D   G  TV A  L DI R L +GA I    E   G  + I  G S F L + P +E+P
Sbjct: 61  SDSQDGRTTVPARKLLDICRGLPEGADIRLNTE---GERLIIRSGRSRFNLSTLPATEYP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ E V  F++    LK L++ T F+MA++++RYYLNG+ F    E   L  VATDGH
Sbjct: 118 NIEDWESVLEFDIGQLELKKLIDATQFSMASQDVRYYLNGMLFE--SEGHGLRTVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA    ++V +      +I+PRK V E++R+L ++D  V++ +  S +   ++    + 
Sbjct: 176 RLATCRREVVTESLPDHQVILPRKGVLELVRLLEAEDKPVRLQIGRSNLRAALDGFIFTS 235

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+++ VIP ++DK L     +LRQA  R +I+S+ + + V+L+L  + L +T 
Sbjct: 236 KLVDGRFPDWRRVIPRNSDKALIAGREDLRQAFARAAILSNEKFRGVRLNLQENLLRITA 295

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ +       D++   L  S SS  I
Sbjct: 296 NNPEQEEAEELLDVQYEAGEMEIGFNVSYVLDVLNTLKC-----DQIRISLSDSISSAII 350

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D DS+       +A YV+MPMRI
Sbjct: 351 --EDFDSQ-------DAQYVVMPMRI 367


>gi|153827733|ref|ZP_01980400.1| DNA polymerase III, beta chain [Vibrio cholerae MZO-2]
 gi|229515948|ref|ZP_04405405.1| DNA polymerase III beta subunit [Vibrio cholerae TMA 21]
 gi|149737791|gb|EDM52696.1| DNA polymerase III, beta chain [Vibrio cholerae MZO-2]
 gi|229347048|gb|EEO12010.1| DNA polymerase III beta subunit [Vibrio cholerae TMA 21]
          Length = 366

 Score =  221 bits (563), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 121/386 (31%), Positives = 216/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ERS +++ L      +  + ++P+  ++LL+  +  L + A+  E+E+   +   
Sbjct: 1   MKFTIERSHLIKPLQQVSGTLGGRASLPILGNLLLKVEENQLSMTATDLEVELISRVTLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   GSITV A    DI R L D A I+   E   G  + +  G S F L + P S+FP
Sbjct: 61  GEFEAGSITVPARKFLDICRGLPDSAVITVLLE---GDRIQVRSGRSRFSLATLPASDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +      L  + L+ L+E+T F+MA +++RYYLNG+ F I+   L+  +VATDGH
Sbjct: 118 NIEDWQSEVQVSLTQAELRGLIEKTQFSMANQDVRYYLNGMLFEIDGTTLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AVA+  + A  A+   IIVPRK V E++++L + +  V + +  S +   +     + 
Sbjct: 176 RMAVAQAQLGADFAQ-KQIIVPRKGVLELVKLLDAPEQPVVLQIGHSNLRAEVNHFVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P    K L+  C  LRQA  R +I+S+ + + V+++L+ +++ +T 
Sbjct: 235 KLVDGRFPDYRRVLPQHTSKTLQAGCEELRQAFSRAAILSNEKFRGVRVNLADNEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V +   P++I FN  Y+L++++ +       D V   +  +N+S  +
Sbjct: 295 NNPEQEEAEELLDVSFEGEPIEIGFNVSYILDVLNTLRC-----DNVRVSMSDANASALV 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              D  S         A YV+MP+R+
Sbjct: 350 ENVDDGS---------AMYVVMPIRL 366


>gi|121998016|ref|YP_001002803.1| DNA polymerase III subunit beta [Halorhodospira halophila SL1]
 gi|121589421|gb|ABM62001.1| DNA polymerase III, beta subunit [Halorhodospira halophila SL1]
          Length = 366

 Score =  221 bits (563), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 126/385 (32%), Positives = 208/385 (54%), Gaps = 19/385 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+  V+R  +L  L     ++ER+ T+PV  ++ ++A    L++ A+  E+E+   + A+
Sbjct: 1   MRFEVQREPLLAALQSIVGVVERRQTLPVLGNIRVEARSQQLQLTATDLEVELVAYLEAN 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               G IT+ A    DI R L +GA IS     +  T   +    S F L + P  EFP 
Sbjct: 61  TKDEGVITLPARKWLDICRNLPEGASISIEANQDRAT---LRAASSRFSLATLPADEFPE 117

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
            +      + E+    L+ L+ERTHF+MA  ++RYYLNG+   +     +  AVATDGHR
Sbjct: 118 VESIGDTEAVEIPRGELRRLIERTHFSMAQHDVRYYLNGLLLELTGSGAR--AVATDGHR 175

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LA+AE D   Q+A+   +IVPRK V E+LR+L   D    +    + + + ++S+ ++ +
Sbjct: 176 LALAESDSPVQVAQPRQVIVPRKGVQELLRLLDDADEPATLEFGTNHVRVTLQSVRLTSK 235

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDG FP+Y  VIP   DK + ++   LRQA+ RV+I+S+ + + ++ ++  D L +   
Sbjct: 236 LIDGVFPDYNRVIPQDGDKHVLIDRQYLRQALTRVAILSNEKYRGIRFAVEGDTLRIGSH 295

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           NP+  +A E + + Y    +++ FN  YLL+ +  + +     + V   L  ++SS  IR
Sbjct: 296 NPEQEEAEEELGIEYGGEAVELGFNANYLLDALGALDT-----ERVQVTLTDASSSGLIR 350

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
            +  D         NA YV+MPMR+
Sbjct: 351 AEGSD---------NARYVVMPMRL 366


>gi|88705399|ref|ZP_01103110.1| DNA polymerase III, beta chain [Congregibacter litoralis KT71]
 gi|88700489|gb|EAQ97597.1| DNA polymerase III, beta chain [Congregibacter litoralis KT71]
          Length = 367

 Score =  221 bits (563), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 128/386 (33%), Positives = 209/386 (54%), Gaps = 20/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK  V R  +L+ L     ++ER+ T+PV  +VLL  +   L I  +  E+E+ G +   
Sbjct: 1   MKFRVSRDALLKPLNLVAGVVERRQTLPVLSNVLLNLDGDRLSITGTDLEVELVGRVNLE 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
           +    G ITV A  L DI + L DGA +     +   T   +  G S F L + P  EFP
Sbjct: 61  TAGEAGEITVPARKLADICKSLPDGADLEIAVADGKAT---VRSGRSRFTLATLPAREFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++    + F L    L+ L+ERT FAMA +++RYYLNG+++ +    L+  AVATDGH
Sbjct: 118 NIEDSIGTHQFTLKQGQLRRLIERTGFAMAQQDVRYYLNGMYWELRAGRLR--AVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA+       +  +   +I+PRK V E+ R++ S D  V + L  + +       + + 
Sbjct: 176 RLAICTFPGTLKDLEDTQVILPRKGVLELSRLMQSDDEDVTIILGSNHLRATTAEFTFTS 235

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG+FP+Y+ V+P + DK ++ + T LRQA  R +I+S+ + + V+L LS   L +  
Sbjct: 236 KLVDGKFPDYERVLPRAADKIVQSSRTELRQAFTRTAILSNEKYRGVRLKLSEGSLEIVA 295

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A ES+ V Y+   ++I FN  YLL+++  +S      +++ F L   NSS  +
Sbjct: 296 NNPEQEQAEESLPVDYSGDALEIGFNVGYLLDVLGVLSG-----EKIRFSLSDPNSSALL 350

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              D           ++ YV+MPMR+
Sbjct: 351 EETDGG---------DSLYVVMPMRL 367


>gi|238917985|ref|YP_002931499.1| DNA polymerase III subunit beta [Edwardsiella ictaluri 93-146]
 gi|269137360|ref|YP_003294060.1| DNA polymerase III, beta subunit [Edwardsiella tarda EIB202]
 gi|238867553|gb|ACR67264.1| DNA polymerase III, beta subunit, putative [Edwardsiella ictaluri
           93-146]
 gi|267983020|gb|ACY82849.1| DNA polymerase III, beta subunit [Edwardsiella tarda EIB202]
 gi|304557461|gb|ADM40125.1| DNA polymerase III beta subunit [Edwardsiella tarda FL6-60]
          Length = 366

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 129/386 (33%), Positives = 215/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK  VER  +++ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +P  
Sbjct: 1   MKFIVEREHLIKPLQQVSSPLGGRPTLPILGNLLLQVEDGHLSLTGTDLEMEMVARVPLV 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A    DI R L DGA+IS   +   G  + +  G S F L + P ++FP
Sbjct: 61  QPHEAGATTVPARKFLDICRGLPDGAEISVALD---GDRMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATLKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E++R+L   ++ +++ +  + +  ++     + 
Sbjct: 176 RLAVCSMPI-GQSLPSHSVIVPRKGVIELMRLLDGGETPLRLQIGSNNLRAHVGGFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKALEAGCDELKQAFARAAILSNEKFRGVRLHVSHNQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    ++I FN  Y+L++++ +       + VV  L  + SSV I
Sbjct: 295 NNPEQEEAEELLDVDYPGSDLEIGFNVSYVLDVLNALKC-----ERVVMMLTDAVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+        A YV+MPMR+
Sbjct: 350 --EDAASQ-------AAVYVVMPMRL 366


>gi|254515868|ref|ZP_05127928.1| DNA polymerase III, beta subunit [gamma proteobacterium NOR5-3]
 gi|219675590|gb|EED31956.1| DNA polymerase III, beta subunit [gamma proteobacterium NOR5-3]
          Length = 367

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 128/386 (33%), Positives = 210/386 (54%), Gaps = 20/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK  V R  +L+ L     ++ER+ T+PV  +VLL  +   L I  +  E+E+ G +   
Sbjct: 1   MKFRVSRDALLKPLNLVAGVVERRQTLPVLSNVLLNLDGDRLSITGTDLEVELVGRVNLE 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
           S    G IT+ A  L DI + L DGA +     +   T   +  G S F L + P  EFP
Sbjct: 61  SEGDAGEITLPARKLADICKSLPDGADLEISVSDGKAT---VRSGRSRFTLATLPAREFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++    + F L    L+ L+ERT FAMA +++RYYLNG+++ +    L+  AVATDGH
Sbjct: 118 NIEDSIGTHQFTLKQGQLRRLIERTGFAMAQQDVRYYLNGMYWELRAGRLR--AVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA+       +  +   +I+PRK V E+ R++ + D  V + L  + +       + + 
Sbjct: 176 RLAICTFPGTLKDLEDTQVILPRKGVLELSRLMQNDDEDVTIILGSNHLRATTTEFTFTS 235

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG+FP+Y+ V+P + DK ++ + T LRQA  R +I+S+ + + V+L LS+  L +  
Sbjct: 236 KLVDGKFPDYERVLPRAADKIVQSSRTELRQAFTRTAILSNEKYRGVRLKLSNGSLEIVA 295

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E++ V Y+   ++I FN  YLL+++  +S      DE+ F L   NSS  +
Sbjct: 296 NNPEQEQAEENLPVNYSGDSLEIGFNVGYLLDVLGVLSG-----DEIRFSLSDPNSSALL 350

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              D           ++ YV+MPMR+
Sbjct: 351 EETDGG---------DSLYVVMPMRL 367


>gi|317046240|ref|YP_004113888.1| DNA polymerase III subunit beta [Pantoea sp. At-9b]
 gi|316947857|gb|ADU67332.1| DNA polymerase III, beta subunit [Pantoea sp. At-9b]
          Length = 366

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 129/386 (33%), Positives = 215/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK  VER  +L+ L      +  + T+P+  ++LLQ N+G L +  +  E+E+   +   
Sbjct: 1   MKFIVEREQLLKPLQQVSGPLGGRPTLPILGNLLLQVNEGTLLLTGTDLEMEMVARVALT 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A    DI R L DGA+I+   E   G  + +  G S F L + P S+FP
Sbjct: 61  QPHEPGATTVPARKFLDICRGLPDGAEITLTLE---GDRMLVRSGRSRFSLSTLPASDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATLKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E++R+L   ++ ++V +  S I  ++     + 
Sbjct: 176 RLAVCSMPI-GQALPNHSVIVPRKGVIELVRLLDGGETPLQVQIGSSNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V++ ++ ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKALEAGCDLLKQAFARAAILSNEKFRGVRIYITENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V YN   ++I FN  Y+L++++ +  + V       RL  ++S   +
Sbjct: 295 NNPEQEEAEEMLDVSYNGSELEIGFNVSYVLDVLNALKCENV-------RLLLTDSVSSV 347

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +D  S         A YV+MPMR+
Sbjct: 348 QIEDVASP-------AAAYVVMPMRL 366


>gi|152972608|ref|YP_001337754.1| DNA polymerase III subunit beta [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238897211|ref|YP_002921959.1| DNA polymerase III subunit beta [Klebsiella pneumoniae NTUH-K2044]
 gi|262040465|ref|ZP_06013708.1| DNA polymerase III [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|330005214|ref|ZP_08305173.1| DNA polymerase III, beta subunit [Klebsiella sp. MS 92-3]
 gi|150957457|gb|ABR79487.1| DNA polymerase III subunit beta [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238549541|dbj|BAH65892.1| DNA polymerase III subunit beta [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|259042218|gb|EEW43246.1| DNA polymerase III [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|328536346|gb|EGF62708.1| DNA polymerase III, beta subunit [Klebsiella sp. MS 92-3]
          Length = 366

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 130/386 (33%), Positives = 216/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +   
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGALSLTGTDLEMEMVARVALV 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E   G  + +  G S F L + P ++FP
Sbjct: 61  QPHEAGATTVPARKFFDICRGLPEGAEIAVQLE---GDRMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F     +L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGSELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + + A +    S+IVPRK V E++R+L   D+ ++V +  + I  ++     + 
Sbjct: 176 RLAVCSMPLEASLPNH-SVIVPRKGVIELMRMLDGGDTPLRVQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKHLEAGCDILKQAFARAAILSNEKFRGVRLYVSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVTYAGTEMEIGFNVSYVLDVLNALKC-----ENVRILLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       +A YV+MPMR+
Sbjct: 350 --EDAASQ-------SAAYVVMPMRL 366


>gi|283787599|ref|YP_003367464.1| DNA polymerase III beta-subunit [Citrobacter rodentium ICC168]
 gi|282951053|emb|CBG90731.1| DNA polymerase III beta-subunit [Citrobacter rodentium ICC168]
          Length = 366

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 132/386 (34%), Positives = 215/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPA- 59
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +   
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALI 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E   G  + +  G S F L + P ++FP
Sbjct: 61  QAHEPGATTVPARKFFDICRGLPEGAEIAVQLE---GDRMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  +  V Q     S+IVPRK V E++R+L   D+ + V +  + I  ++     + 
Sbjct: 176 RLAVCSMP-VGQSLPSHSVIVPRKGVIELMRMLDGGDNPLHVQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKHLEAGCDILKQAFARAAILSNEKFRGVRLYVSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVTYPGTEMEIGFNVSYVLDVLNALKC-----ETVRIMLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       +A YV+MPMR+
Sbjct: 350 --EDAASQ-------SAAYVVMPMRL 366


>gi|258622959|ref|ZP_05717974.1| DNA polymerase III, beta chain [Vibrio mimicus VM573]
 gi|258626083|ref|ZP_05720934.1| DNA polymerase III, beta chain [Vibrio mimicus VM603]
 gi|262172779|ref|ZP_06040457.1| DNA polymerase III beta subunit [Vibrio mimicus MB-451]
 gi|258581609|gb|EEW06507.1| DNA polymerase III, beta chain [Vibrio mimicus VM603]
 gi|258584742|gb|EEW09476.1| DNA polymerase III, beta chain [Vibrio mimicus VM573]
 gi|261893855|gb|EEY39841.1| DNA polymerase III beta subunit [Vibrio mimicus MB-451]
          Length = 366

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 120/386 (31%), Positives = 217/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ERS +++ L      +  + ++P+  ++LL+  +  L + A+  E+E+   +   
Sbjct: 1   MKFTIERSHLIKPLQQVSGTLGGRASLPILGNLLLKVEENQLSMTATDLEVELISRVTLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   GSITV A    DI R L D A I+   E   G  + +  G S F L + P ++FP
Sbjct: 61  GEFEAGSITVPARKFLDICRGLPDSAVITVLLE---GDRIQVRSGRSRFSLATLPANDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +      L  + L+ L+E+T F+MA +++RYYLNG+ F I+   L+  +VATDGH
Sbjct: 118 NIEDWQSEVQVSLTQAELRGLIEKTQFSMANQDVRYYLNGMLFEIDGTTLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AVA+  + A  A+   IIVPRK V E++++L + +  V + +  S +   +     + 
Sbjct: 176 RMAVAQAQLGADFAQ-KQIIVPRKGVLELVKLLDAPEQPVVLQIGHSNLRAEVNHFVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P    K L+  C  LRQA  R +I+S+ + + V+++L+ +++ +T 
Sbjct: 235 KLVDGRFPDYRRVLPQHTSKTLQAGCEELRQAFSRAAILSNEKFRGVRVNLADNEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V +   P++I FN  Y+L++++ +       + V   +  +N+S  +
Sbjct: 295 NNPEQEEAEELLDVSFEGEPIEIGFNVSYILDVLNTLRC-----ENVRVSMSDANASALV 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              D DS         A YV+MP+R+
Sbjct: 350 ENVDDDS---------AMYVVMPIRL 366


>gi|308188764|ref|YP_003932895.1| DNA polymerase III, beta-subunit [Pantoea vagans C9-1]
 gi|308059274|gb|ADO11446.1| DNA polymerase III, beta-subunit [Pantoea vagans C9-1]
          Length = 384

 Score =  220 bits (561), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 131/386 (33%), Positives = 215/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  VER  +L+ L      +  + T+P+  ++LLQ  +G L +  +  E+E+   +  +
Sbjct: 19  MKFIVEREQLLKPLQQVSGPLGGRPTLPILGNLLLQVTEGSLLLTGTDLEMEMVARVALT 78

Query: 61  -VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                GS TV A    DI R L DGA+I+   E   G  + +  G S F L + P S+FP
Sbjct: 79  QAHEPGSTTVPARKFLDICRGLPDGAEITLALE---GDRMLVRSGRSRFSLSTLPASDFP 135

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 136 NLDDWQSEVEFTLPQATLKRLIEATQFSMAHQDVRYYLNGMMFETEGEELR--TVATDGH 193

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E+LR+L   ++ ++V +  S I  ++     + 
Sbjct: 194 RLAVCSMPI-GQALPSHSVIVPRKGVIELLRLLDGGENPLQVQIGGSNIRAHVGDYIFTS 252

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L ++ ++L +T 
Sbjct: 253 KLVDGRFPDYRRVLPKNPDKALEAGCDLLKQAFARAAILSNEKFRGVRLYITENQLKITA 312

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V YN   ++I FN  Y+L++++ +  + V       RL  ++S   +
Sbjct: 313 NNPEQEEAEEMLDVSYNGTELEIGFNVSYVLDVLNALKCENV-------RLLLTDSVSSV 365

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +D  S         A YV+MPMR+
Sbjct: 366 QIEDVASP-------AAAYVVMPMRL 384


>gi|315125113|ref|YP_004067116.1| DNA polymerase III subunit beta [Pseudoalteromonas sp. SM9913]
 gi|315013626|gb|ADT66964.1| DNA polymerase III subunit beta [Pseudoalteromonas sp. SM9913]
          Length = 367

 Score =  220 bits (561), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 127/386 (32%), Positives = 218/386 (56%), Gaps = 20/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+IT+ R   L+ L      IERK+T+P+  +VLL   +G L +  +  EIE+  ++   
Sbjct: 1   MQITISREQFLKPLVQVSGAIERKHTLPILSNVLLVVENGQLSMTGTDLEIELVASVFVG 60

Query: 61  VDVCGS-ITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            DV  + +T+ A  L DI + L DG+ ++   ++    ++ ++ G S F L +    +FP
Sbjct: 61  DDVADTKLTLPAKKLLDICKSLPDGSDLTLSLQDH---QLLLTSGKSRFSLTTLAAEDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +    F+L    L+ L+E THF+MA +++RYYLNG+ F ++  D+K   VATDGH
Sbjct: 118 NLEQWDGEVEFQLTRLELRKLLESTHFSMANQDVRYYLNGMSFEVDNSDIK--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA+A+  +   +     +I+PRK V EI+R++ +    V +    + I +     + + 
Sbjct: 176 RLAIAQKQLGQSLNTQRQLIIPRKGVQEIMRLMVADQELVTIQFGANHIRIIDIEFTFTS 235

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P   DK +  N   LR A  RVSI+S+ + + V+L+LS+  L +T 
Sbjct: 236 KLVDGRFPDYRRVLPRGGDKVITANREWLRNAFQRVSILSNEKFRGVRLNLSNGLLKITA 295

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E + V Y    ++I FN  Y+L++++ + +     ++V+F L  SNSS  I
Sbjct: 296 NNPEQEQAEEVVEVMYEGDDLEIGFNVSYVLDVLNTLKT-----EDVLFTLADSNSSALI 350

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
            G   +          A YV+MPMR+
Sbjct: 351 EGAGDEE---------AMYVVMPMRL 367


>gi|50123358|ref|YP_052525.1| DNA polymerase III subunit beta [Pectobacterium atrosepticum
           SCRI1043]
 gi|49613884|emb|CAG77336.1| DNA polymerase III, beta chain [Pectobacterium atrosepticum
           SCRI1043]
          Length = 366

 Score =  220 bits (561), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 126/386 (32%), Positives = 217/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK  VER  +L+ L      +  + T+P+  ++L+Q  +G L +  +  E+E+   +   
Sbjct: 1   MKFIVERERLLKPLQQVSSPLGGRPTLPILGNLLIQVTEGALSLTGTDLEMEMVAKVALT 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A  L+DI R L +GA+I+   +   G  + +  G S F L + P ++FP
Sbjct: 61  QPHEPGATTVPARKLFDICRGLPEGAEITIMLD---GDRMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F    EDL+   VATDGH
Sbjct: 118 NLDDWQSDVEFSLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEDLR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + 
Sbjct: 176 RLAVCSMPI-GQSLPSHSVIVPRKGVMELVRLLDGGDTPLQLQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L  +C  L+QA  R +I+S+ + + V+L L  ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLEASCDLLKQAFSRAAILSNEKFRGVRLHLIQNQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y+   M+I FN  Y+L++++ +  + V       RL  ++S   +
Sbjct: 295 NNPEQEEAEEILDVQYDGTEMEIGFNVSYVLDVLNALKCEGV-------RLLLTDSVSSV 347

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +D  S+        A YV+MPMR+
Sbjct: 348 QIEDSASR-------AAAYVVMPMRL 366


>gi|270264120|ref|ZP_06192387.1| DNA polymerase III, beta subunit [Serratia odorifera 4Rx13]
 gi|270041769|gb|EFA14866.1| DNA polymerase III, beta subunit [Serratia odorifera 4Rx13]
          Length = 366

 Score =  220 bits (561), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 128/386 (33%), Positives = 219/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  VER  +L+ L      +  + T+P+  ++LLQ  +G L +  +  E+E+   +  S
Sbjct: 1   MKFIVEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVTEGCLLLTGTDLEMEMVARVALS 60

Query: 61  -VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E+E    + +  G S F L + P  +FP
Sbjct: 61  QPHEAGATTVPARKFFDICRGLPEGAEIAVTLESE---RMLVRSGRSRFSLSTLPAVDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATLKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q+    S+IVPRK V E++R+L   D+ +++ +  + I  ++     + 
Sbjct: 176 RLAVCSMPIGQQLPSH-SVIVPRKGVMELVRLLDGGDTLLQLQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLEAGCDLLKQAFARAAILSNEKFRGVRLYVSQNQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y+   M+I FN  Y+L++++ +  ++V       RL  ++S   +
Sbjct: 295 NNPEQEEAEEILDVSYDGTEMEIGFNVSYVLDVLNALKCEDV-------RLLLTDSVSSV 347

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +D  S+        A YV+MPMR+
Sbjct: 348 QIEDGASQ-------AAAYVVMPMRL 366


>gi|85057980|ref|YP_453682.1| DNA polymerase III subunit beta [Sodalis glossinidius str.
           'morsitans']
 gi|84778500|dbj|BAE73277.1| DNA polymerase III beta subunit protein DnaN [Sodalis glossinidius
           str. 'morsitans']
          Length = 366

 Score =  220 bits (561), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 133/386 (34%), Positives = 217/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  VER  +L+ L      +  + T+P+  ++LLQ ++  L +  +  E+E+   +  S
Sbjct: 1   MKFIVEREQLLKPLQQVSSPLGGRPTLPILGNLLLQVSEDRLLLTGTDLEMEMVAQVALS 60

Query: 61  V-DVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E   G  + I  G S + L + P S FP
Sbjct: 61  AAHEPGATTVPARKFFDICRGLPEGAEIAVTLE---GERMLIRSGRSRYSLSTLPASNFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L+ S+LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLSQSILKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  +  V +     S+IVPRK V E++R+L   ++ VK+ +  + I  ++     + 
Sbjct: 176 RLAVCAMS-VGEALPSHSVIVPRKGVMELVRMLDGGENPVKLQIGSNNIRASVGDYIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L LS+++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLEAGCDVLKQAFARAAILSNEKFRGVRLYLSANQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ +       +EV   L    SSV I
Sbjct: 295 NNPEQEEAEEILDVTYQGSEMEIGFNVSYVLDVLNALKC-----EEVRLLLTDGVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
               +DS +       A YV+MPMR+
Sbjct: 350 ----EDSASQA-----AAYVVMPMRL 366


>gi|206578911|ref|YP_002235887.1| DNA polymerase III, beta subunit [Klebsiella pneumoniae 342]
 gi|288932894|ref|YP_003436953.1| DNA polymerase III subunit beta [Klebsiella variicola At-22]
 gi|290511690|ref|ZP_06551058.1| DNA polymerase III, beta subunit [Klebsiella sp. 1_1_55]
 gi|206567969|gb|ACI09745.1| DNA polymerase III, beta subunit [Klebsiella pneumoniae 342]
 gi|288887623|gb|ADC55941.1| DNA polymerase III, beta subunit [Klebsiella variicola At-22]
 gi|289775480|gb|EFD83480.1| DNA polymerase III, beta subunit [Klebsiella sp. 1_1_55]
          Length = 366

 Score =  220 bits (560), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 130/386 (33%), Positives = 216/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +   
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGALSLTGTDLEMEMVARVALV 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E   G  + +  G S F L + P ++FP
Sbjct: 61  QPHEAGATTVPARKFFDICRGLPEGAEIAVQLE---GDRMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F     +L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGSELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + + A +    S+IVPRK V E++R+L   D+ ++V +  + I  ++     + 
Sbjct: 176 RLAVCSMPLEASLPNH-SVIVPRKGVIELMRMLDGGDTPLRVQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKHLDAGCDILKQAFARAAILSNEKFRGVRLYVSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVTYAGTEMEIGFNVSYVLDVLNALKC-----ENVRILLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       +A YV+MPMR+
Sbjct: 350 --EDAASQ-------SAAYVVMPMRL 366


>gi|294627437|ref|ZP_06706021.1| DNA polymerase III subunit beta [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292598258|gb|EFF42411.1| DNA polymerase III subunit beta [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 366

 Score =  220 bits (560), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 125/385 (32%), Positives = 217/385 (56%), Gaps = 19/385 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ T++R   L+ L     ++ER+ T+PV  ++L+Q  DG + +  +  E+E+       
Sbjct: 1   MRFTLQREAFLKPLAQVVNVVERRQTLPVLANLLVQVKDGQVSLTGTDLEVEMISRTLVE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               G  T+ A  L+DI+R L DG++++    ++ G +V +  G S F L + P ++FPS
Sbjct: 61  DAQDGETTIPARKLFDILRALPDGSRVTI---SQTGDKVTVQAGRSRFTLATLPSNDFPS 117

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
             E E      +  + LK L+ERT FAMA +++RYYLNG+ F + +  L+ C VATDGHR
Sbjct: 118 VDEVEATERVVVPEAGLKELIERTAFAMAQQDVRYYLNGLLFDLRDGLLR-C-VATDGHR 175

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LA+ E+++         IIVPRK V E+ R+L   D  V++ +  S I +    ++ + +
Sbjct: 176 LALCEIELEKAGGAKRQIIVPRKGVTELQRLLEGADREVELEVGRSHIRVKRGDVTFTSK 235

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDG FP+Y+ VIP   D+E++V+   LR ++ R +I+S+ + + V++ +S  +L ++  
Sbjct: 236 LIDGRFPDYEAVIPIGADREVKVDREALRASLQRAAILSNEKYRGVRVEVSPGQLKISAH 295

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           NP+  +A E +        + I FN  YLL+ +  +      D+ VV +L  +NSS  +R
Sbjct: 296 NPEQEEAQEEIEAETKVDDLAIGFNVNYLLDALSALR-----DEHVVIQLRDANSSALVR 350

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
             +  S+ ++       +V+MP+R+
Sbjct: 351 --EASSEKSR-------HVVMPLRL 366


>gi|220933195|ref|YP_002512094.1| DNA polymerase III, beta subunit [Thioalkalivibrio sp. HL-EbGR7]
 gi|219994505|gb|ACL71107.1| DNA polymerase III, beta subunit [Thioalkalivibrio sp. HL-EbGR7]
          Length = 366

 Score =  220 bits (560), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 124/385 (32%), Positives = 205/385 (53%), Gaps = 19/385 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ +++R D+L+ L      +ER+ T+P+  +VL++A++  L +  +  E+E+       
Sbjct: 1   MRFSIQREDLLKPLQQVIGAVERRQTMPILANVLIKADEDRLSVTGTDLEVELVAEASEV 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               G  TV A  L DI R L D A +    E   G  V I+ G + F L + P ++FP+
Sbjct: 61  SASPGEATVPARKLLDICRALPDEASLEIQAE---GDRVLITSGRARFTLSALPAADFPA 117

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
             E        L    L++L+ RT FAMA +++RYYLNG+   + +  ++   VATDGHR
Sbjct: 118 LDEISSSKELTLTERELRHLILRTSFAMANQDVRYYLNGLMLEVGQNVIR--TVATDGHR 175

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LA+ E++     A    +I+PRK V E+LR+L   D  V++ +  + I   +  L  + +
Sbjct: 176 LALCELNTTVDTASSQQVIIPRKGVQELLRLLEDSDEPVRLQIGANHIRATLPRLRFTSK 235

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDG FP+Y  VIP   D+ ++V    LR+A+ R SI+S+ + + ++L L    L +   
Sbjct: 236 LIDGRFPDYDRVIPKDGDQVMKVEREALRKALARASILSNEKYRGIRLVLGDGLLRIQAH 295

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           NP+  +A + +   Y    M+I FN  YLL++++ +  D +   E  F+   +NSSV +R
Sbjct: 296 NPEQEEAEDEIEAQYTGTAMEIGFNVTYLLDVLNTVEGDVI---EATFK--DANSSVLMR 350

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
                         +A YV+MPMR+
Sbjct: 351 DP---------GATDALYVVMPMRL 366


>gi|123444341|ref|YP_001008306.1| DNA polymerase III subunit beta [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|332163520|ref|YP_004300097.1| DNA polymerase III subunit beta [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|122091302|emb|CAL14188.1| DNA polymerase III, beta subunit protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|318608024|emb|CBY29522.1| DNA polymerase III beta subunit [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325667750|gb|ADZ44394.1| DNA polymerase III subunit beta [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 366

 Score =  220 bits (560), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 129/386 (33%), Positives = 219/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  +ER  +L+ L      +  + T+P+  ++LLQ  +G L +  +  E+E+   +  S
Sbjct: 1   MKFIIEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVTEGSLLLTGTDLEMEMVARVALS 60

Query: 61  -VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   +   G  + +  G S F L + P ++FP
Sbjct: 61  HPHEQGATTVPARKFFDIWRGLPEGAEITVALD---GDRLLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + 
Sbjct: 176 RLAVCAMPI-GQTLPSHSVIVPRKGVMELVRLLDGGDTPLRLQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L+ +C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLKASCDLLKQAFARAAILSNEKFRGVRLYVSQNQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y+   M+I FN  Y+L++++ +       ++V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVSYDGAEMEIGFNVSYVLDVLNALKC-----EDVSLLLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+        A YV+MPMR+
Sbjct: 350 --EDGASQ-------AAAYVVMPMRL 366


>gi|195546611|ref|YP_002117639.1| p081 [Rhizobium phage 16-3]
 gi|102642576|gb|ABF71357.1| p081 [Rhizobium phage 16-3]
          Length = 378

 Score =  219 bits (559), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 132/386 (34%), Positives = 208/386 (53%), Gaps = 30/386 (7%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK+ + R+ +  +L +  R++E +NTIP+   + L A DG L +  +  +I  T    A 
Sbjct: 21  MKLLIGRAGLTRVLTNVSRVVEARNTIPILSSLRLSAADGKLTVTGTDLDIVATDTAAAD 80

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V   G++ V A LL DI +K   G  +S  ++     ++ +  G S F L + P ++FP 
Sbjct: 81  VTEGGAVCVDAKLLSDIAKKT--GGDVSLSEDK---GQLIVKSGRSRFSLPALPAADFPD 135

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEE-DLKLCAVATDGH 179
               EY  SF++    L  L     FA++TEE R+YLNGIF H++E+ D  + AVATDGH
Sbjct: 136 LSGGEYTASFDMD---LAALFAPVSFAISTEETRFYLNGIFLHLHEDGDYFIRAVATDGH 192

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RL+  +     + A    +IVPRK VG + +       +V+VS+SE++I +      ++ 
Sbjct: 193 RLSRHQAAYPGEDA-FKGVIVPRKTVGLLPK------GTVRVSVSETKIRIASGEFVLTS 245

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +LIDG FP+YQ VIP  NDK++     ++RQA  RVS++SS R +AVKLS +  +  + V
Sbjct: 246 KLIDGTFPDYQRVIPTQNDKKIVFGSDDMRQAASRVSVISSERGRAVKLSFAEGEAKLAV 305

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
            +P+ G A + + V Y+  P+DI FN  YL E++    + ++     +   D  + SVF 
Sbjct: 306 SSPETGSATDEIFVNYDGDPIDIGFNAAYLTELVGIFPAGDI----TLALADGGSPSVF- 360

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
                      +       VLMPMR+
Sbjct: 361 ---------TSEKAPELLAVLMPMRV 377


>gi|283836134|ref|ZP_06355875.1| hypothetical protein CIT292_10555 [Citrobacter youngae ATCC 29220]
 gi|291068323|gb|EFE06432.1| DNA polymerase III, beta subunit [Citrobacter youngae ATCC 29220]
          Length = 366

 Score =  219 bits (559), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 131/386 (33%), Positives = 216/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPA- 59
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +   
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGALSLTGTDLEMEMVARVALI 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E   G  + +  G S F L + P ++FP
Sbjct: 61  QPHEPGATTVPARKFFDICRGLPEGAEIAVQLE---GDRMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  +  V Q     S+IVPRK V E++R+L   D+ ++V +  + I  ++     + 
Sbjct: 176 RLAVCSMP-VGQPLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKHLEAGCDILKQAFARAAILSNEKFRGVRLYVSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    ++I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVSYPGTELEIGFNVSYVLDVLNALKC-----ENVRIMLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       +A YV+MPMR+
Sbjct: 350 --EDAASQ-------SAAYVVMPMRL 366


>gi|237729023|ref|ZP_04559504.1| DNA polymerase III subunit beta [Citrobacter sp. 30_2]
 gi|226909645|gb|EEH95563.1| DNA polymerase III subunit beta [Citrobacter sp. 30_2]
          Length = 366

 Score =  219 bits (559), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 131/386 (33%), Positives = 216/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPA- 59
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +   
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALI 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E   G  + +  G S F L + P ++FP
Sbjct: 61  QPHEPGATTVPARKFFDICRGLPEGAEIAVQLE---GDRMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  +  V Q     S+IVPRK V E++R+L   D+ ++V +  + I  ++     + 
Sbjct: 176 RLAVCSMP-VGQPLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKHLEAGCDILKQAFARAAILSNEKFRGVRLYVSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    ++I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVSYPGTELEIGFNVSYVLDVLNALKC-----ENVRILLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       +A YV+MPMR+
Sbjct: 350 --EDAASQ-------SAAYVVMPMRL 366


>gi|157144343|ref|YP_001451662.1| DNA polymerase III subunit beta [Citrobacter koseri ATCC BAA-895]
 gi|157081548|gb|ABV11226.1| hypothetical protein CKO_00047 [Citrobacter koseri ATCC BAA-895]
          Length = 366

 Score =  219 bits (559), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 131/386 (33%), Positives = 216/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPA- 59
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +   
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALI 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E   G  + +  G S F L + P ++FP
Sbjct: 61  QPHEPGATTVPARKFFDICRGLPEGAEIAVQLE---GDRMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  +  V Q     S+IVPRK V E++R+L   ++ ++V +  + I  ++     + 
Sbjct: 176 RLAVCSMP-VGQSLPNHSVIVPRKGVIELMRMLDGGETPLRVQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLEAGCDILKQAFARAAILSNEKFRGVRLYVSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVTYGGTEMEIGFNVSYVLDVLNALKC-----ETVRILLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       +A YV+MPMR+
Sbjct: 350 --EDAASQ-------SAAYVVMPMRL 366


>gi|16762488|ref|NP_458105.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29143976|ref|NP_807318.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56415710|ref|YP_152785.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|62182325|ref|YP_218742.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161505632|ref|YP_001572744.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|161616955|ref|YP_001590920.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167548873|ref|ZP_02342632.1| DNA polymerase III, beta subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|168233392|ref|ZP_02658450.1| DNA polymerase III, beta subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168260378|ref|ZP_02682351.1| DNA polymerase III, beta subunit [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|168464832|ref|ZP_02698724.1| DNA polymerase III, beta subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|168818303|ref|ZP_02830303.1| DNA polymerase III, beta subunit [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194471413|ref|ZP_03077397.1| DNA polymerase III, beta subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|197251713|ref|YP_002148775.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197364638|ref|YP_002144275.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|198245644|ref|YP_002217787.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|204928586|ref|ZP_03219785.1| DNA polymerase III, beta subunit [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205354576|ref|YP_002228377.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207859063|ref|YP_002245714.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|213648785|ref|ZP_03378838.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213865135|ref|ZP_03387254.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|224585636|ref|YP_002639435.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|238913090|ref|ZP_04656927.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|289826404|ref|ZP_06545516.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|25288590|pir||AB0958 DNA polymerase III beta-chain [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16504793|emb|CAD03158.1| DNA polymerase III beta-subunit [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29139612|gb|AAO71178.1| DNA polymerase III beta-subunit [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56129967|gb|AAV79473.1| DNA polymerase III beta-subunit [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|62129958|gb|AAX67661.1| DNA polymerase III, beta-subunit [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|160866979|gb|ABX23602.1| hypothetical protein SARI_03808 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|161366319|gb|ABX70087.1| hypothetical protein SPAB_04776 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194457777|gb|EDX46616.1| DNA polymerase III, beta subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|195632425|gb|EDX50909.1| DNA polymerase III, beta subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197096115|emb|CAR61711.1| DNA polymerase III beta-subunit [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|197215416|gb|ACH52813.1| DNA polymerase III, beta subunit [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197940160|gb|ACH77493.1| DNA polymerase III, beta subunit [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|204322019|gb|EDZ07217.1| DNA polymerase III, beta subunit [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205274357|emb|CAR39382.1| DNA polymerase III beta-subunit [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205325570|gb|EDZ13409.1| DNA polymerase III, beta subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205332539|gb|EDZ19303.1| DNA polymerase III, beta subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205344390|gb|EDZ31154.1| DNA polymerase III, beta subunit [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205350419|gb|EDZ37050.1| DNA polymerase III, beta subunit [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206710866|emb|CAR35230.1| DNA polymerase III beta-subunit [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|224470164|gb|ACN47994.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|320088258|emb|CBY98020.1| DNA polymerase III, beta-subunit [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|322617250|gb|EFY14155.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322619062|gb|EFY15948.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625129|gb|EFY21957.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322630180|gb|EFY26951.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322634394|gb|EFY31128.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322635279|gb|EFY31994.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322642897|gb|EFY39481.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322647623|gb|EFY44110.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322650571|gb|EFY46978.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322656403|gb|EFY52695.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322661583|gb|EFY57806.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322661664|gb|EFY57883.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322668222|gb|EFY64380.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322672849|gb|EFY68957.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322674970|gb|EFY71056.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322683660|gb|EFY79673.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322687736|gb|EFY83705.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|322716816|gb|EFZ08387.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|323192049|gb|EFZ77284.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323200531|gb|EFZ85609.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323204957|gb|EFZ89942.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323206700|gb|EFZ91657.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323211772|gb|EFZ96605.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323218634|gb|EGA03341.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323220035|gb|EGA04505.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323224805|gb|EGA09070.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323232486|gb|EGA16588.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323235261|gb|EGA19346.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323241049|gb|EGA25086.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323241401|gb|EGA25433.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323248632|gb|EGA32562.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323252069|gb|EGA35929.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323258627|gb|EGA42290.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323262342|gb|EGA45900.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323268178|gb|EGA51654.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323270592|gb|EGA54037.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326625573|gb|EGE31918.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326629712|gb|EGE36055.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 366

 Score =  219 bits (558), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 130/386 (33%), Positives = 217/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +  S
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVTLS 60

Query: 61  -VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E   G  + +  G S F L + P ++FP
Sbjct: 61  QPHEPGATTVPARKFFDICRGLPEGAEIAVQLE---GDRMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F     +L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGSELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + + A +    S+IVPRK V E++R+L   ++ ++V +  + I  ++     + 
Sbjct: 176 RLAVCSMPLEASLPSH-SVIVPRKGVIELMRMLDGGENPLRVQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKHLEAGCDILKQAFARAAILSNEKFRGVRLYVSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVSYGGTEMEIGFNVSYVLDVLNALKC-----ETVRIMLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       +A YV+MPMR+
Sbjct: 350 --EDAASQ-------SAAYVVMPMRL 366


>gi|238793144|ref|ZP_04636772.1| DNA polymerase III subunit beta [Yersinia intermedia ATCC 29909]
 gi|238727517|gb|EEQ19043.1| DNA polymerase III subunit beta [Yersinia intermedia ATCC 29909]
          Length = 366

 Score =  219 bits (558), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 126/386 (32%), Positives = 217/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  +ER  +L+ L      +  + T+P+  ++LLQ  +G L +  +  E+E+   +  S
Sbjct: 1   MKFIIEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVTEGSLLLTGTDLEMEMVARVALS 60

Query: 61  -VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   +   G  + +  G S F L + P ++FP
Sbjct: 61  NPHTQGATTVPARKFFDIWRGLPEGAEITVALD---GDRLLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + 
Sbjct: 176 RLAVCSMPI-GQTLPSHSVIVPRKGVMELVRLLDGGDTPLRLQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLEAGCDLLKQAFARAAILSNEKFRGVRLYVSHNQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ +  ++V       RL  ++S   +
Sbjct: 295 NNPEQEEAEEILDVSYEGTEMEIGFNVSYVLDVLNALKCEDV-------RLLLTDSVSSV 347

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +D  S+        A YV+MPMR+
Sbjct: 348 QIEDGASQ-------AAAYVVMPMRL 366


>gi|16767122|ref|NP_462737.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|167992431|ref|ZP_02573529.1| DNA polymerase III, beta subunit [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168242057|ref|ZP_02666989.1| DNA polymerase III, beta subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|194444384|ref|YP_002043087.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194449346|ref|YP_002047870.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|200387477|ref|ZP_03214089.1| DNA polymerase III, beta subunit [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|3915668|sp|P26464|DPO3B_SALTY RecName: Full=DNA polymerase III subunit beta
 gi|2653647|gb|AAB87631.1| DNA polymerase III beta clamp subunit [Salmonella enterica subsp.
           enterica serovar Typhimurium]
 gi|16422411|gb|AAL22696.1| DNA polymerase III, beta-subunit [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|194403047|gb|ACF63269.1| DNA polymerase III, beta subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194407650|gb|ACF67869.1| DNA polymerase III, beta subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|199604575|gb|EDZ03120.1| DNA polymerase III, beta subunit [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|205329442|gb|EDZ16206.1| DNA polymerase III, beta subunit [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205338833|gb|EDZ25597.1| DNA polymerase III, beta subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|261248978|emb|CBG26835.1| DNA polymerase III beta-subunit [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267996123|gb|ACY91008.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301160370|emb|CBW19895.1| DNA polymerase III beta-subunit [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312914967|dbj|BAJ38941.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321225555|gb|EFX50610.1| DNA polymerase III beta subunit [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|323132198|gb|ADX19628.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|332990687|gb|AEF09670.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 366

 Score =  219 bits (558), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 130/386 (33%), Positives = 217/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +  S
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVTLS 60

Query: 61  -VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E   G  + +  G S F L + P ++FP
Sbjct: 61  QPHEPGATTVPARKFFDICRGLPEGAEIAVQLE---GDRMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F     +L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIESTQFSMAHQDVRYYLNGMLFETEGSELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + + A +    S+IVPRK V E++R+L   ++ ++V +  + I  ++     + 
Sbjct: 176 RLAVCSMPLEASLPSH-SVIVPRKGVIELMRMLDGGENPLRVQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKHLEAGCDILKQAFARAAILSNEKFRGVRLYVSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVSYGGTEMEIGFNVSYVLDVLNALKC-----ETVRIMLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       +A YV+MPMR+
Sbjct: 350 --EDAASQ-------SAAYVVMPMRL 366


>gi|253987485|ref|YP_003038841.1| DNA polymerase III subunit beta [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253778935|emb|CAQ82095.1| DNA polymerase III subunit beta [Photorhabdus asymbiotica]
          Length = 366

 Score =  219 bits (558), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 132/387 (34%), Positives = 218/387 (56%), Gaps = 23/387 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  +ER  +L+ L      +  + T+P+  ++LLQ  +  L +  +  E+E+   +  S
Sbjct: 1   MKFIIEREQLLKPLQQVSSPLGGRPTLPILGNLLLQVTESSLLLTGTDLEMEMMARVTLS 60

Query: 61  VD-VCGSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEF 118
           +    G+ TV A   +DI R L DGA+IS     EL G  + +  G S F L + P ++F
Sbjct: 61  LPHEEGATTVPARKFFDIWRGLPDGAEISV----ELDGDRLLVRSGRSRFSLSTLPAADF 116

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P+  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDG
Sbjct: 117 PNLDDWQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDG 174

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLAV  + I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     +
Sbjct: 175 HRLAVCSMGI-GQNLPSHSVIVPRKGVIELMRLLDGGDTPLQLQIGSNNIRAHVGDFIFT 233

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +L+DG FP+Y+ V+P + DK L  +C  L+QA  R +I+S+ + + V+L  S ++L +T
Sbjct: 234 SKLVDGRFPDYRRVLPKNPDKTLEASCDMLKQAFSRAAILSNEKFRGVRLYFSKNQLKIT 293

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
            +NP+  +A E ++V Y    M+I FN  Y+L++++ +       +EV   L  + SSV 
Sbjct: 294 ANNPEQEEAEEIVDVSYQGTEMEIGFNVSYVLDVLNTLRC-----EEVRLLLTDAISSVQ 348

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           I    +D  ++     NA YV+MPMR+
Sbjct: 349 I----EDCASH-----NAAYVVMPMRL 366


>gi|329894831|ref|ZP_08270631.1| DNA polymerase III beta subunit [gamma proteobacterium IMCC3088]
 gi|328922725|gb|EGG30059.1| DNA polymerase III beta subunit [gamma proteobacterium IMCC3088]
          Length = 375

 Score =  219 bits (558), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 128/393 (32%), Positives = 217/393 (55%), Gaps = 26/393 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPA- 59
           MK ++ER  +++ L     ++ER+ T+P+  +VL+      L +  +  E+E+TG +   
Sbjct: 1   MKFSIEREALVKPLSLVAGVVERRQTLPILANVLVNVEGSQLSLVGTDLEVELTGRVTLE 60

Query: 60  -SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEF 118
            S  V GS+TV    L+DI + L DG+ I   ++   G ++ +  G S F L + P +EF
Sbjct: 61  DSDSVSGSVTVPGRKLFDICKSLPDGSVIELAQD---GAKLVVKSGRSRFSLATLPATEF 117

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P         S  +    LK L+E+T FAMA +++RYYLNG+ + +N    ++  VATDG
Sbjct: 118 PLVDSLNVRGSMTVDQQALKALIEQTGFAMAQQDVRYYLNGMLWELNANQFRV--VATDG 175

Query: 179 HRLAVAEV---DIVAQIAKMP---SIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNI 232
           HRLA + +   + V Q    P    II+PRK V E+ R+L   D+  +V+L ++ + +  
Sbjct: 176 HRLATSHIVLSEGVVQGLSGPDATQIILPRKGVLELSRLLQPGDAPAEVALGDNHLKVET 235

Query: 233 ESLSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSS 292
            S +   +L+DG+FP+YQ V+P ++ K +      L+ A+ R +I+S+ + + ++L LSS
Sbjct: 236 ASFTFISKLVDGKFPDYQRVLPKNSTKTVVGERDVLKSALSRAAILSNEKYRGIRLHLSS 295

Query: 293 DKLCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDS 352
           D+L +  +NP+  +A E ++V Y   P++I FN  YLL+++  I      +D V   L  
Sbjct: 296 DQLQVVANNPEQEEAEEIISVDYQGEPLEIGFNVSYLLDVLGVIH-----EDSVKVSLSD 350

Query: 353 SNSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            + S  +   D+ +        NA YV+MPMR+
Sbjct: 351 PSGSALLEAADEHA--------NAMYVVMPMRL 375


>gi|37678196|ref|NP_932805.1| DNA polymerase III subunit beta [Vibrio vulnificus YJ016]
 gi|37196935|dbj|BAC92776.1| DNA polymerase III, beta chain [Vibrio vulnificus YJ016]
          Length = 366

 Score =  219 bits (557), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 120/386 (31%), Positives = 215/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ RS  ++ L      +  + T+P+  ++L+   +G L + A+  E+E+   +   
Sbjct: 1   MKFTIARSHFIKPLQQVSGALGGRPTLPILGNLLINVENGQLSMTATDLEVELISKVTLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   GSITV +    DI R L D A I+F  E   G  V +  G S F L + P ++FP
Sbjct: 61  GEFEAGSITVPSRKFLDICRGLPDDAVITFVLE---GDRVQVRSGRSRFSLATLPANDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +      L    L+ L+E+T F+MA +++RYYLNG+ F I+   L+  +VATDGH
Sbjct: 118 NIEDWQSEVEVSLTQGELRALIEKTQFSMANQDVRYYLNGMLFEIDGSTLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AVA+  + A  A+   IIVPRK V E++++L + +  V + +  S +   +     + 
Sbjct: 176 RMAVAQAPLSADFAQ-KQIIVPRKGVQELVKLLDTPEQPVTLQIGSSNLRAEVNHFVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P    K L  +C  LRQA  R +I+S+ + + V+++L+  ++ +T 
Sbjct: 235 KLVDGRFPDYRRVLPQHTTKTLEASCDELRQAFSRAAILSNEKFRGVRVNLAGSEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V ++   ++I FN  Y+L++++ +       ++V   +  +N+S  +
Sbjct: 295 NNPEQEEAEEMLDVSFDGEAIEIGFNVSYVLDVLNTLRC-----EQVRISMSDANASALV 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              D DS         A YV+MP+R+
Sbjct: 350 ENVDDDS---------AMYVVMPIRL 366


>gi|323462780|pdb|2XUR|A Chain A, The G157c Mutation In The Escherichia Coli Sliding Clamp
           Specifically Affects Initiation Of Replication
 gi|323462781|pdb|2XUR|B Chain B, The G157c Mutation In The Escherichia Coli Sliding Clamp
           Specifically Affects Initiation Of Replication
          Length = 373

 Score =  219 bits (557), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 131/386 (33%), Positives = 216/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +   
Sbjct: 8   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALV 67

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E E    + +  G S F L + P ++FP
Sbjct: 68  QPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGE---RMLVRSGRSRFSLSTLPAADFP 124

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLN + F    E+L+   VATDGH
Sbjct: 125 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNCMLFETEGEELR--TVATDGH 182

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E++R+L   D+ ++V +  + I  ++     + 
Sbjct: 183 RLAVCSMPI-GQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTS 241

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 242 KLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITA 301

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y+   M+I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 302 NNPEQEEAEEILDVTYSGAEMEIGFNVSYVLDVLNALKC-----ENVRMMLTDSVSSVQI 356

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       +A YV+MPMR+
Sbjct: 357 --EDAASQ-------SAAYVVMPMRL 373


>gi|168235477|ref|ZP_02660535.1| DNA polymerase III, beta subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|194738233|ref|YP_002116781.1| DNA polymerase III subunit beta [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|194713735|gb|ACF92956.1| DNA polymerase III, beta subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197291529|gb|EDY30881.1| DNA polymerase III, beta subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
          Length = 366

 Score =  219 bits (557), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 130/386 (33%), Positives = 217/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +  S
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVTLS 60

Query: 61  -VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E   G  + +  G S F L + P ++FP
Sbjct: 61  QPHEPGATTVPARKFFDICRGLPEGAEIAVQLE---GDRMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F     +L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGSELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + + A +    S+IVPRK V E++R+L   ++ ++V +  + I  ++     + 
Sbjct: 176 RLAVCSMPLEASLPSH-SVIVPRKGVIELMRMLDGGENPLRVQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKHLEAGCDILKQAFARAAILSNEKFRGVRLYVSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVSYGGMEMEIGFNVSYVLDVLNALKC-----ETVRIMLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       +A YV+MPMR+
Sbjct: 350 --EDAASQ-------SAAYVVMPMRL 366


>gi|307543591|ref|YP_003896070.1| DNA polymerase III subunit beta [Halomonas elongata DSM 2581]
 gi|307215615|emb|CBV40885.1| DNA polymerase III subunit beta [Halomonas elongata DSM 2581]
          Length = 367

 Score =  219 bits (557), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 127/386 (32%), Positives = 204/386 (52%), Gaps = 20/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK ++ R  +L  L     ++ER+ T+PV  +VL+Q     + +  +  E+E+ G   AS
Sbjct: 1   MKFSISREALLRPLTLVAGVVERRQTLPVLSNVLIQVEQDQVSLTGTDLEVELIGRTVAS 60

Query: 61  -VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            VD  GS TV A  L DI + L D A+I    E+       +  G S F L + P +EFP
Sbjct: 61  QVDEAGSATVPARKLMDICKSLPDQAEIQLALEDNRAV---LRSGRSRFTLSTLPVAEFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +      L    LK L++ T FAMA +++RYYLNG+        ++  AVATDGH
Sbjct: 118 NIEDGQSSVELSLPRGTLKRLIDATSFAMAQQDVRYYLNGMLLEFGTNLVR--AVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAVA      Q+     +IVPRK + E++R+L   +  V ++L  + I  +    + + 
Sbjct: 176 RLAVASRSAEIQVEPSQKLIVPRKGIMELVRLLDDGEDPVSLTLGSTHIRAHTGDFTFTS 235

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG+FP+Y+ V+P   DK L    T LRQ + R +I+S+ + + V+L+L    L +  
Sbjct: 236 KLVDGKFPDYERVVPKGGDKVLIAERTELRQVLSRTAILSNEKYRGVRLNLEEGNLRVMA 295

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E++ V Y    M+I FN  YL++++  +      +D V   L   NSS  +
Sbjct: 296 NNPEQEEAEENVGVEYTGPAMEIGFNVGYLVDVLSVLD-----EDRVQLTLADPNSSALL 350

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
                     +    +A YV+MPMR+
Sbjct: 351 ---------EEPGGGDALYVVMPMRL 367


>gi|227113115|ref|ZP_03826771.1| DNA polymerase III subunit beta [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
 gi|227328544|ref|ZP_03832568.1| DNA polymerase III subunit beta [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
 gi|261819372|ref|YP_003257478.1| DNA polymerase III subunit beta [Pectobacterium wasabiae WPP163]
 gi|261603385|gb|ACX85871.1| DNA polymerase III, beta subunit [Pectobacterium wasabiae WPP163]
          Length = 366

 Score =  219 bits (557), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 125/386 (32%), Positives = 217/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK  VER  +L+ L      +  + T+P+  ++L+Q  +G L +  +  E+E+   +   
Sbjct: 1   MKFIVERERLLKPLQQVSSPLGGRPTLPILGNLLIQVTEGALSLTGTDLEMEMVAKVALT 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A  L+DI R L +GA+I+   +   G  + +  G S F L + P ++FP
Sbjct: 61  QPHEPGATTVPARKLFDICRGLPEGAEITIMLD---GDRMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFSLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  +  V Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + 
Sbjct: 176 RLAVCSMP-VGQSLPSHSVIVPRKGVMELVRLLDGGDTPLQLQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L  +C  L+QA  R +I+S+ + + V+L L  ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLEASCDLLKQAFSRAAILSNEKFRGVRLHLIQNQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y+   M+I FN  Y+L++++ +  + V       RL  ++S   +
Sbjct: 295 NNPEQEEAEEILDVQYDGTEMEIGFNVSYVLDVLNALKCEGV-------RLLLTDSVSSV 347

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +D  S+        A YV+MPMR+
Sbjct: 348 QIEDSASR-------AAAYVVMPMRL 366


>gi|238759585|ref|ZP_04620747.1| DNA polymerase III subunit beta [Yersinia aldovae ATCC 35236]
 gi|238702244|gb|EEP94799.1| DNA polymerase III subunit beta [Yersinia aldovae ATCC 35236]
          Length = 366

 Score =  219 bits (557), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 129/386 (33%), Positives = 217/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  +ER  +L+ L      +  + T+P+  ++LLQ  +G L +  +  E+E+   +  S
Sbjct: 1   MKFIIEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVTEGSLLLTGTDLEMEMVARVALS 60

Query: 61  -VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   +   G  + +  G S F L + P ++FP
Sbjct: 61  HPHEQGATTVPARKFFDIWRGLPEGAEITVALD---GDRLLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + 
Sbjct: 176 RLAVCSMPI-GQTLPSHSVIVPRKGVMELVRLLDGGDTPLRLQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLEAGCDLLKQAFARAAILSNEKFRGVRLYVSHNQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y+   M+I FN  Y+L++++ +       ++V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVSYDGTEMEIGFNVSYVLDVLNALKC-----EDVRLLLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
               +DS +       A YV+MPMR+
Sbjct: 350 ----EDSASQA-----AAYVVMPMRL 366


>gi|238783049|ref|ZP_04627076.1| DNA polymerase III subunit beta [Yersinia bercovieri ATCC 43970]
 gi|238716050|gb|EEQ08035.1| DNA polymerase III subunit beta [Yersinia bercovieri ATCC 43970]
          Length = 366

 Score =  219 bits (557), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 126/386 (32%), Positives = 218/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  +ER  +L+ L      +  + T+P+  ++LLQ  +G L +  +  E+E+   +  S
Sbjct: 1   MKFIIEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVTEGSLRLTGTDLEMEMVACVALS 60

Query: 61  -VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   +   G  + +  G S F L + P  +FP
Sbjct: 61  QPHEQGATTVPARKFFDIWRGLPEGAEITVALD---GDRLLVRSGRSRFSLSTLPAVDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + 
Sbjct: 176 RLAVCSMPI-GQTLPSHSVIVPRKGVMELVRLLDGGDTPLRLQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L  +C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLEASCDLLKQAFARAAILSNEKFRGVRLYVSQNQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y+   M+I FN  Y+L++++ +  ++V       RL  ++S   +
Sbjct: 295 NNPEQEEAEEILDVSYDGTEMEIGFNVSYVLDVLNALKCEDV-------RLLLTDSVSSV 347

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +D  S+        A YV+MPMR+
Sbjct: 348 QIEDGASQ-------AAAYVVMPMRL 366


>gi|221135256|ref|ZP_03561559.1| DNA polymerase III, beta subunit [Glaciecola sp. HTCC2999]
          Length = 368

 Score =  219 bits (557), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 127/387 (32%), Positives = 220/387 (56%), Gaps = 21/387 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ R   L+ L      IER++T+P+  ++LL   +G+L +  +  E+E+   +  +
Sbjct: 1   MKFTISREQFLQPLQLVSGAIERRHTLPILSNILLVVKEGVLTLTGTDLEVELISHLSLA 60

Query: 61  VDVC--GSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEF 118
            D    G ITV A  L DI R L DG  I+F  +   GT+  I  G   + L +   S++
Sbjct: 61  ADSYEDGEITVPAKKLVDICRGLSDGNDITFQVD---GTKATIRSGRGRYTLSTLSASDY 117

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P+ ++ +    F ++ + LK+L++ T FAMA +++RYYLNG+   +  ED  +  VATDG
Sbjct: 118 PNLEDWQADVEFVISQNDLKHLIDSTSFAMAQQDVRYYLNGM--SLETEDNNIRTVATDG 175

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA+  +    +   +  +I+PRK V EI R++ + D+SVKV +  + I +       +
Sbjct: 176 HRLALCNLAYTTETLPVRQVIIPRKGVLEINRLIEANDNSVKVKIGSNHISVKSSGFVFT 235

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +L+DG FP+++ V+P    K +  N   +++A  R SI+S+ + + V+L+LS+ +L +T
Sbjct: 236 SKLVDGRFPDHRRVLPKETTKAVTANKDVMKKAFSRASILSNEKFRGVRLNLSNGELKIT 295

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
            +NP+  +A E ++V Y    ++I FN  YL+++++ + +     DEV F L  S++S  
Sbjct: 296 ANNPEQEEAEEIVDVNYQGEELEIGFNVAYLIDVMNALKT-----DEVKFNLSDSSASAL 350

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           I    +D+ N+      A YV+MPMR+
Sbjct: 351 I----EDATNS-----TALYVIMPMRL 368


>gi|295095339|emb|CBK84429.1| DNA polymerase III, beta subunit [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 366

 Score =  218 bits (556), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 129/386 (33%), Positives = 217/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +  +
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMIARVTLT 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E   G  + +  G S F L + P ++FP
Sbjct: 61  QPHDAGATTVPARKFFDICRGLPEGAEIAVQLE---GDRMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I   +    S+IVPRK V E++R+L   ++ ++V +  + I  ++     + 
Sbjct: 176 RLAVCSMPIGDSLPNH-SVIVPRKGVIELMRMLDGGETPLRVQIGSNNIRAHVGDFVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S +++ +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLEAGCDILKQAFARAAILSNEKFRGVRLYVSENQIKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVTYAGAEMEIGFNVSYVLDVLNALKC-----ENVRILLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       +A YV+MPMR+
Sbjct: 350 --EDAASQ-------SAAYVVMPMRL 366


>gi|289662283|ref|ZP_06483864.1| DNA polymerase III subunit beta [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|289667648|ref|ZP_06488723.1| DNA polymerase III subunit beta [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 366

 Score =  218 bits (556), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 125/385 (32%), Positives = 217/385 (56%), Gaps = 19/385 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ T++R   L+ L     ++ER+ T+PV  ++L+Q  DG + +  +  E+E+       
Sbjct: 1   MRFTLQREAFLKPLAQVVNVVERRQTLPVLANLLVQVKDGQVSLTGTDLEVEMISRTMVE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               G  T+ A  L+DI+R L DG++++    ++ G +V +  G S F L + P ++FPS
Sbjct: 61  DAQDGETTIPARKLFDILRALPDGSRVTI---SQTGDKVTVQAGRSRFTLATLPANDFPS 117

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
             E E      +  + LK L+ERT FAMA +++RYYLNG+ F + +  L+ C VATDGHR
Sbjct: 118 VDEVEATERVVVPEAGLKELIERTAFAMAQQDVRYYLNGLLFDLRDGLLR-C-VATDGHR 175

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LA+ E+++         IIVPRK V E+ R+L   D  V++ +  S I +    ++ + +
Sbjct: 176 LALCEMELEKAGGAKRQIIVPRKGVTELQRLLEGADREVELEVGRSHIRVKRGDVTFTSK 235

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDG FP+Y+ VIP   D+E++V+   LR ++ R +I+S+ + + V++ +S  +L ++  
Sbjct: 236 LIDGRFPDYEAVIPIGADREVKVDREALRASLQRAAILSNEKYRGVRVEVSPGQLKISAH 295

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           NP+  +A E +        + I FN  YLL+ +  +      D+ VV +L  +NSS  +R
Sbjct: 296 NPEQEEAQEEIEADTKVDDLAIGFNVNYLLDALSALR-----DEHVVIQLRDANSSALVR 350

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
             +  S+ ++       +V+MP+R+
Sbjct: 351 --EASSEKSR-------HVVMPLRL 366


>gi|261341639|ref|ZP_05969497.1| hypothetical protein ENTCAN_08107 [Enterobacter cancerogenus ATCC
           35316]
 gi|288315996|gb|EFC54934.1| DNA polymerase III, beta subunit [Enterobacter cancerogenus ATCC
           35316]
          Length = 366

 Score =  218 bits (556), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 129/386 (33%), Positives = 217/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +  +
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMIARVTLT 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E   G  + +  G S F L + P ++FP
Sbjct: 61  QPHNAGATTVPARKFFDICRGLPEGAEIAVQLE---GDRMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I   +    S+IVPRK V E++R+L   ++ ++V +  + I  ++     + 
Sbjct: 176 RLAVCSMPIGDSLPNH-SVIVPRKGVIELMRMLDGGETPLRVQIGSNNIRAHVGDFVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S +++ +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLEAGCDILKQAFARAAILSNEKFRGVRLYVSENQIKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVTYAGAEMEIGFNVSYVLDVLNALKC-----ENVRILLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       +A YV+MPMR+
Sbjct: 350 --EDAASQ-------SAAYVVMPMRL 366


>gi|21240776|ref|NP_640358.1| DNA polymerase III subunit beta [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|78045558|ref|YP_361733.1| DNA polymerase III subunit beta [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325926218|ref|ZP_08187576.1| DNA polymerase III, beta subunit [Xanthomonas perforans 91-118]
 gi|21106040|gb|AAM34894.1| DNA polymerase III beta chain [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|78033988|emb|CAJ21633.1| DNA polymerase III beta chain [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325543400|gb|EGD14825.1| DNA polymerase III, beta subunit [Xanthomonas perforans 91-118]
          Length = 366

 Score =  218 bits (556), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 125/385 (32%), Positives = 217/385 (56%), Gaps = 19/385 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ T++R   L+ L     ++ER+ T+PV  ++L+Q  DG + +  +  E+E+       
Sbjct: 1   MRFTLQREAFLKPLAQVVNVVERRQTLPVLANLLVQVKDGQVSLTGTDLEVEMISRTLVE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               G  T+ A  L+DI+R L DG++++    ++ G +V +  G S F L + P ++FPS
Sbjct: 61  DAQDGETTIPARKLFDILRALPDGSRVTI---SQTGDKVTVQAGRSRFTLATLPSNDFPS 117

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
             E E      +  + LK L+ERT FAMA +++RYYLNG+ F + +  L+ C VATDGHR
Sbjct: 118 VDEVEATERVVVPEAGLKELIERTAFAMAQQDVRYYLNGLLFDLRDGLLR-C-VATDGHR 175

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LA+ E+++         IIVPRK V E+ R+L   D  V++ +  S I +    ++ + +
Sbjct: 176 LALCEMELEKAGGAKRQIIVPRKGVTELQRLLEGADREVELEVGRSHIRVKRGDVTFTSK 235

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDG FP+Y+ VIP   D+E++V+   LR ++ R +I+S+ + + V++ +S  +L ++  
Sbjct: 236 LIDGRFPDYEAVIPIGADREVKVDREALRASLQRAAILSNEKYRGVRVEVSPGQLKISAH 295

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           NP+  +A E +        + I FN  YLL+ +  +      D+ VV +L  +NSS  +R
Sbjct: 296 NPEQEEAQEEIEADTKVDDLAIGFNVNYLLDALSALR-----DEHVVIQLRDANSSALVR 350

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
             +  S+ ++       +V+MP+R+
Sbjct: 351 --EASSEKSR-------HVVMPLRL 366


>gi|238797844|ref|ZP_04641336.1| DNA polymerase III subunit beta [Yersinia mollaretii ATCC 43969]
 gi|238718260|gb|EEQ10084.1| DNA polymerase III subunit beta [Yersinia mollaretii ATCC 43969]
          Length = 366

 Score =  218 bits (556), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 126/386 (32%), Positives = 218/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  +ER  +L+ L      +  + T+P+  ++LLQ  +G L +  +  E+E+   +  S
Sbjct: 1   MKFIIEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVTEGSLRLTGTDLEMEMVACVALS 60

Query: 61  -VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   +   G  + +  G S F L + P  +FP
Sbjct: 61  QPHEQGATTVPARKFFDIWRGLPEGAEITVALD---GDRLLVRSGRSRFSLSTLPAVDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSDVEFTLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + 
Sbjct: 176 RLAVCSMPI-GQTLPSHSVIVPRKGVMELVRLLDGGDTPLRLQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L  +C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLEASCDLLKQAFARAAILSNEKFRGVRLYVSQNQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y+   M+I FN  Y+L++++ +  ++V       RL  ++S   +
Sbjct: 295 NNPEQEEAEEILDVSYDGTEMEIGFNVSYVLDVLNALKCEDV-------RLLLTDSVSSV 347

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +D  S+        A YV+MPMR+
Sbjct: 348 QIEDGASQ-------AAAYVVMPMRL 366


>gi|146309669|ref|YP_001174743.1| DNA polymerase III subunit beta [Enterobacter sp. 638]
 gi|145316545|gb|ABP58692.1| DNA polymerase III, beta subunit [Enterobacter sp. 638]
          Length = 366

 Score =  218 bits (556), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 130/386 (33%), Positives = 216/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +  S
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVTLS 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E   G  + +  G S F L + P  +FP
Sbjct: 61  QPHDAGATTVPARKFFDICRGLPEGAEIAVQLE---GDRILVRSGRSRFSLSTLPAIDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I   +    S+IVPRK V E++R+L   ++ ++V +  + I  ++     + 
Sbjct: 176 RLAVCSMPIGVTLPNH-SVIVPRKGVIELMRMLDGGENPLRVQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S +++ +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLEAGCDILKQAFARAAILSNEKFRGVRLYVSENQIKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVTYAGTEMEIGFNVSYVLDVLNALKC-----ENVRILLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       +A YV+MPMR+
Sbjct: 350 --EDAASQ-------SAAYVVMPMRL 366


>gi|163802134|ref|ZP_02196029.1| DNA polymerase III subunit beta [Vibrio sp. AND4]
 gi|159173939|gb|EDP58749.1| DNA polymerase III subunit beta [Vibrio sp. AND4]
          Length = 366

 Score =  218 bits (556), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 123/386 (31%), Positives = 220/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ERS +++ L      +  + T+P+  ++LL+  D +L + A+  E+E+   +   
Sbjct: 1   MKFTIERSHLIKPLQQVSGALGGRPTLPILGNLLLKVEDNVLSMTATDLEVELVSKVTLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D   GSITV +    DI R L D + I+F  E   G  V +    S F L + P ++FP
Sbjct: 61  GDFEAGSITVPSRKFLDICRGLPDDSIITFVLE---GDRVQVRSSRSRFSLSTLPANDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +      L  S L++LVE+T F+MA +++RYYLNG+ F I+   L+  +VATDGH
Sbjct: 118 NIEDWQSEVEVSLTQSDLRSLVEKTQFSMANQDVRYYLNGMLFEIDGSTLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AV++  + A  A+   IIVPRK + E+++++ + +  V + +  S +   + +   + 
Sbjct: 176 RMAVSQTQLGADFAQ-KQIIVPRKGIQELVKLMDAPEQPVVLQIGSSNVRAEVNNFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P S +K L   C  LRQA  R +I+S+ + + V+++L+  ++ +T 
Sbjct: 235 KLVDGRFPDYRRVLPQSTNKTLETGCDELRQAFSRAAILSNEKFRGVRVNLAGSEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V +    ++I FN  Y+L++++ +       D+V   +  +N+S  I
Sbjct: 295 NNPEQEEAEEILDVTFEGDAIEIGFNVSYVLDVLNTLRC-----DKVRVSMSDANASALI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              D DS         A YV+MP+R+
Sbjct: 350 ENADDDS---------AMYVVMPIRL 366


>gi|330827702|ref|YP_004390654.1| DNA polymerase III subunit beta [Aeromonas veronii B565]
 gi|328802838|gb|AEB48037.1| DNA polymerase III, beta subunit [Aeromonas veronii B565]
          Length = 367

 Score =  218 bits (555), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 130/388 (33%), Positives = 219/388 (56%), Gaps = 24/388 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAI--- 57
           M++ + R  +L  L      +  + T+P+  +VLL  ++GLL +  +  E+E+ G +   
Sbjct: 1   MQLEISREALLRPLQLVSGALGGRPTLPILGNVLLDVSNGLLSLTGTDLEVEMIGQVYLN 60

Query: 58  PASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESE 117
            AS D  G  TV A  L DI R L +GA+I    E   G  + I  G S F L + P +E
Sbjct: 61  GASED--GRTTVPARKLLDICRGLPEGAEIRLNTE---GERLIIRSGRSRFNLSTLPATE 115

Query: 118 FPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATD 177
           +P+ ++ E V  F+++   LK L++ T F+MA++++RYYLNG+ F    E   L  VATD
Sbjct: 116 YPNIEDWESVLEFDISQLELKKLIDATQFSMASQDVRYYLNGMLFE--SEGHGLRTVATD 173

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLA    ++V +      +I+PRK V E++R+L ++D  V++ +  S +   ++    
Sbjct: 174 GHRLATCRREVVGESLPDHQVILPRKGVLELVRLLEAEDKPVRLQIGRSNLRAALDGFIF 233

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +L+DG FP+++ VIP ++DK L     +LRQA  R +I+S+ + + V+L+L  + L +
Sbjct: 234 TSKLVDGRFPDWRRVIPRNSDKALIAGREDLRQAFARAAILSNEKFRGVRLNLQENLLRI 293

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           T +NP+  +A E ++V Y    M+I FN  Y+L++++ +       D++   L  S SS 
Sbjct: 294 TANNPEQEEAEELLDVQYAAGEMEIGFNVSYVLDVLNTLKC-----DQIRISLSDSISSA 348

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            I    +D ++      +A YV+MPMRI
Sbjct: 349 II----EDFEHQ-----DAQYVVMPMRI 367


>gi|212712613|ref|ZP_03320741.1| hypothetical protein PROVALCAL_03708 [Providencia alcalifaciens DSM
           30120]
 gi|212684829|gb|EEB44357.1| hypothetical protein PROVALCAL_03708 [Providencia alcalifaciens DSM
           30120]
          Length = 366

 Score =  218 bits (555), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 124/386 (32%), Positives = 220/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  +ER  +L+ L      +  + T+P+  ++LL   +G L++  +  E+E+   +P +
Sbjct: 1   MKFIIEREQLLKPLQQVSGPLGGRPTLPILGNLLLHVKEGALQLTGTDLEMEMMANVPLT 60

Query: 61  VD-VCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   G+ TV A   +DI R L +G++I     ++    + +  G S F L + P ++FP
Sbjct: 61  REHEIGATTVPARKFFDIWRGLPEGSEIQVELNDD---RLLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  S+LK L+E T F+MA +++RYYLNG+ F    E   L  V+TDGH
Sbjct: 118 NLDDWQSEVEFSLPQSILKRLIEATQFSMAHQDVRYYLNGMLFET--EGNMLRTVSTDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  +DI  ++    S+IVPRK V E++R+L   D+ +++ +  + I  ++     + 
Sbjct: 176 RLAVCSMDIGQELPSH-SVIVPRKGVMELMRLLDGGDALLQLQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L  S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLEARCDLLKQAFSRAAILSNEKFRGVRLFFSENQLRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ + S+ V     +F  D+ +S   +
Sbjct: 295 NNPEQEEAEEIVDVNYQGGEMEIGFNVSYILDVLNALKSENV----TLFLTDAVSS---V 347

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +D  S+       +A YV+MPMR+
Sbjct: 348 QIEDSASR-------SAVYVVMPMRL 366


>gi|54307246|ref|YP_128266.1| DNA polymerase III subunit beta [Photobacterium profundum SS9]
 gi|46911666|emb|CAG18464.1| Putative DNA polymerase III, beta chain [Photobacterium profundum
           SS9]
          Length = 366

 Score =  218 bits (555), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 121/386 (31%), Positives = 220/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK TVER  +L+ L      +  + ++P+  ++LL+  +G L +  +  E+E+   +   
Sbjct: 1   MKFTVEREHLLKPLQQVSGALGGRPSLPILGNILLKVEEGYLSMTGTDLEVELIAKLALE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D   G++TV +    DI R L DGA+I+   E   G  + I  G S + L + P ++FP
Sbjct: 61  ADFEVGAVTVPSRKFLDICRGLPDGAKIAVTLE---GDRILIRSGRSRYSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +    F L    +  L++ T F+MA +++RYYLNG+ F  +   L+  +VATDGH
Sbjct: 118 NIEDWQSDVEFTLPQGRMSQLIQSTQFSMAHQDVRYYLNGMLFETDGSHLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AV  +D+ AQ      IIVPRK V E++R+L + ++ V + +  S I   + +   + 
Sbjct: 176 RMAVCAIDL-AQELTTKQIIVPRKGVLELVRLLDNAEAMVDIQIGNSNIRATVNNFVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P S++K +  +C  LR+A  R +I+S+ + + V+++LS  ++ +T 
Sbjct: 235 KLVDGRFPDYRRVMPQSSNKFVEASCDELRKAFSRAAILSNEKFRGVRVNLSKGEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    ++I FN  Y+L++++ +       D+V   L  +N+S  +
Sbjct: 295 NNPEQEEAEEFLDVDYQGDDLEIGFNVSYVLDVLNTLKC-----DQVRLSLTDANASALV 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
               +D  N++     A YV+MP+R+
Sbjct: 350 ----EDCANDE-----AMYVVMPIRL 366


>gi|22127980|ref|NP_671403.1| DNA polymerase III subunit beta [Yersinia pestis KIM 10]
 gi|45443727|ref|NP_995266.1| DNA polymerase III subunit beta [Yersinia pestis biovar Microtus
           str. 91001]
 gi|51598226|ref|YP_072417.1| DNA polymerase III subunit beta [Yersinia pseudotuberculosis IP
           32953]
 gi|108810132|ref|YP_654048.1| DNA polymerase III subunit beta [Yersinia pestis Antiqua]
 gi|108814114|ref|YP_649881.1| DNA polymerase III subunit beta [Yersinia pestis Nepal516]
 gi|150260969|ref|ZP_01917697.1| DNA polymerase III, beta subunit protein [Yersinia pestis
           CA88-4125]
 gi|153950603|ref|YP_001403094.1| DNA polymerase III subunit beta [Yersinia pseudotuberculosis IP
           31758]
 gi|162419235|ref|YP_001608447.1| DNA polymerase III subunit beta [Yersinia pestis Angola]
 gi|165926167|ref|ZP_02221999.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165936833|ref|ZP_02225399.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166009556|ref|ZP_02230454.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166213164|ref|ZP_02239199.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|167401667|ref|ZP_02307161.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167422858|ref|ZP_02314611.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167425558|ref|ZP_02317311.1| DNA polymerase III, beta subunit [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167470925|ref|ZP_02335629.1| DNA polymerase III, beta subunit [Yersinia pestis FV-1]
 gi|170022264|ref|YP_001718769.1| DNA polymerase III subunit beta [Yersinia pseudotuberculosis YPIII]
 gi|186893346|ref|YP_001870458.1| DNA polymerase III subunit beta [Yersinia pseudotuberculosis PB1/+]
 gi|218931073|ref|YP_002348948.1| DNA polymerase III subunit beta [Yersinia pestis CO92]
 gi|229839803|ref|ZP_04459962.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229841888|ref|ZP_04462044.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229896765|ref|ZP_04511928.1| DNA polymerase III, beta subunit [Yersinia pestis Pestoides A]
 gi|229904653|ref|ZP_04519764.1| DNA polymerase III, beta subunit [Yersinia pestis Nepal516]
 gi|270488364|ref|ZP_06205438.1| DNA polymerase III, beta subunit [Yersinia pestis KIM D27]
 gi|294505624|ref|YP_003569686.1| DNA polymerase III subunit beta [Yersinia pestis Z176003]
 gi|21961125|gb|AAM87654.1|AE014012_11 DNA polymerase III, beta-subunit [Yersinia pestis KIM 10]
 gi|45438597|gb|AAS64143.1| DNA polymerase III, beta subunit protein [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51591508|emb|CAH23180.1| DNA polymerase III, beta subunit protein [Yersinia
           pseudotuberculosis IP 32953]
 gi|108777762|gb|ABG20281.1| DNA polymerase III, beta subunit [Yersinia pestis Nepal516]
 gi|108782045|gb|ABG16103.1| DNA polymerase III, beta subunit [Yersinia pestis Antiqua]
 gi|115349684|emb|CAL22665.1| DNA polymerase III, beta subunit protein [Yersinia pestis CO92]
 gi|149290377|gb|EDM40454.1| DNA polymerase III, beta subunit protein [Yersinia pestis
           CA88-4125]
 gi|152962098|gb|ABS49559.1| DNA polymerase III, beta subunit [Yersinia pseudotuberculosis IP
           31758]
 gi|162352050|gb|ABX85998.1| DNA polymerase III, beta subunit [Yersinia pestis Angola]
 gi|165915075|gb|EDR33686.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165922027|gb|EDR39204.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165991478|gb|EDR43779.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166205462|gb|EDR49942.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|166958250|gb|EDR55271.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167049049|gb|EDR60457.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167055572|gb|EDR65365.1| DNA polymerase III, beta subunit [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169748798|gb|ACA66316.1| DNA polymerase III, beta subunit [Yersinia pseudotuberculosis
           YPIII]
 gi|186696372|gb|ACC87001.1| DNA polymerase III, beta subunit [Yersinia pseudotuberculosis
           PB1/+]
 gi|229678771|gb|EEO74876.1| DNA polymerase III, beta subunit [Yersinia pestis Nepal516]
 gi|229691227|gb|EEO83280.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229696169|gb|EEO86216.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229700203|gb|EEO88239.1| DNA polymerase III, beta subunit [Yersinia pestis Pestoides A]
 gi|262363788|gb|ACY60509.1| DNA polymerase III subunit beta [Yersinia pestis D106004]
 gi|262367725|gb|ACY64282.1| DNA polymerase III subunit beta [Yersinia pestis D182038]
 gi|270336868|gb|EFA47645.1| DNA polymerase III, beta subunit [Yersinia pestis KIM D27]
 gi|294356083|gb|ADE66424.1| DNA polymerase III subunit beta [Yersinia pestis Z176003]
 gi|320017426|gb|ADW00998.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 366

 Score =  218 bits (555), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 129/386 (33%), Positives = 215/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  +ER  +L+ L      +  + T+P+  ++LLQ  +G L +  +  E+E+   +  S
Sbjct: 1   MKFIIEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVTEGSLRLTGTDLEMEMVACVALS 60

Query: 61  VD-VCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   +   G  + +  G S F L + P  +FP
Sbjct: 61  QSHEPGATTVPARKFFDIWRGLPEGAEITVALD---GDRLLVRSGRSRFSLSTLPAIDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + 
Sbjct: 176 RLAVCSMPI-GQTLPSHSVIVPRKGVMELVRLLDGGDTPLRLQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKMLEAGCDLLKQAFSRAAILSNEKFRGVRLYVSHNQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ +       ++V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVSYEGTEMEIGFNVSYVLDVLNALKC-----EDVRLLLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
               +DS +       A YV+MPMR+
Sbjct: 350 ----EDSASQA-----AAYVVMPMRL 366


>gi|294665123|ref|ZP_06730426.1| DNA polymerase III subunit beta [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292605124|gb|EFF48472.1| DNA polymerase III subunit beta [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 366

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 125/385 (32%), Positives = 217/385 (56%), Gaps = 19/385 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ T++R   L+ L     ++ER+ T+PV  ++L+Q  DG + +  +  E+E+       
Sbjct: 1   MRFTLQREAFLKPLAQVVNVVERRQTLPVLANLLVQVKDGQVSLTGTDLEVEMISRTLVE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               G  T+ A  L+DI+R L DG++++    ++ G +V +  G S F L + P ++FPS
Sbjct: 61  DAQDGETTIPARKLFDILRALPDGSRVTI---SQTGDKVTVQAGRSRFTLATLPSNDFPS 117

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
             E E      +  + LK L+ERT FAMA +++RYYLNG+ F + +  L+ C VATDGHR
Sbjct: 118 VDEVEATERVVVPEAGLKELIERTAFAMAQQDVRYYLNGLLFDLRDGLLR-C-VATDGHR 175

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LA+ E+++         IIVPRK V E+ R+L   D  V++ +  S I +    ++ + +
Sbjct: 176 LALCEMELENAGGAKRQIIVPRKGVTELQRLLEGADREVELEVGRSHIRVKRGDVTFTSK 235

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDG FP+Y+ VIP   D+E++V+   LR ++ R +I+S+ + + V++ +S  +L ++  
Sbjct: 236 LIDGRFPDYEAVIPIGADREVKVDREALRASLQRAAILSNEKYRGVRVEVSPGQLKISAH 295

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           NP+  +A E +        + I FN  YLL+ +  +      D+ VV +L  +NSS  +R
Sbjct: 296 NPEQEEAQEEIEADTKVDDLAIGFNVNYLLDALSALR-----DEHVVIQLRDANSSALVR 350

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
             +  S+ ++       +V+MP+R+
Sbjct: 351 --EASSEKSR-------HVVMPLRL 366


>gi|329297782|ref|ZP_08255118.1| DNA polymerase III subunit beta [Plautia stali symbiont]
          Length = 366

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 128/386 (33%), Positives = 216/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  VER  +L+ L      +  + T+P+  ++LLQ N+G L +  +  E+E+   +  +
Sbjct: 1   MKFIVEREQLLKPLQQVSGPLGGRPTLPILGNLLLQVNEGTLLLTGTDLEMEMVARVALT 60

Query: 61  -VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A    DI R L +GA+IS   E   G  + +  G S F L + P S+FP
Sbjct: 61  QPHEPGATTVPARKFLDICRGLPEGAEISLTLE---GDRMLVRSGRSRFSLSTLPASDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATLKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  +  V Q     S+IVPRK V E++R+L   ++ ++V +  S I  ++     + 
Sbjct: 176 RLAVCSMP-VGQALPNHSVIVPRKGVIELVRLLDGGETPLQVQIGSSNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V++ ++ ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKALEAGCDLLKQAFARAAILSNEKFRGVRIYITENQLRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y+   ++I FN  Y+L++++ +  + V       RL  ++S   +
Sbjct: 295 NNPEQEEAEEMLDVSYSGTELEIGFNVSYVLDVLNALKCENV-------RLLLTDSVSSV 347

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +D  S         A YV+MPMR+
Sbjct: 348 QIEDVASP-------AAAYVVMPMRL 366


>gi|94502202|ref|ZP_01308697.1| DNA polymerase III subunit beta [Oceanobacter sp. RED65]
 gi|94425663|gb|EAT10676.1| DNA polymerase III subunit beta [Oceanobacter sp. RED65]
          Length = 367

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 130/386 (33%), Positives = 217/386 (56%), Gaps = 20/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITG-AIPA 59
           MK+T+ R  +L+ L     ++ER+ T+PV  +VLL+     L +  +  E+E+ G A   
Sbjct: 1   MKLTITREALLKPLQLVAGVVERRQTLPVLSNVLLEVKGDQLSLTGTDLELELIGSATLL 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
              V G+ITV A  L DI + L D + I   +++    +V +  G S F L S P +EFP
Sbjct: 61  EPGVDGAITVPAKKLMDICKSLPDQSTIEISQDDH---KVQLQTGRSKFVLSSLPANEFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + E      +  + L+ +++RT FAMA +++RYYLNG+   +  ++L+  AVATDGH
Sbjct: 118 NIDDIEAQAQVMVPQTQLRRIIDRTAFAMAQQDVRYYLNGMLIEVKPDELR--AVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA   V +   IA    +IVPRKAV E+ ++L   +SSV++SLS + +   +   + + 
Sbjct: 176 RLATCGVPVELDIADRMQVIVPRKAVLELAKLLMDPESSVELSLSNNHVRAKVGDYTFTS 235

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG+FP+Y+ VIP + +K L  +   LRQ   R +I+S+ + + V+L L +D L +  
Sbjct: 236 KLVDGKFPDYERVIPRNGNKTLIADRQALRQVFQRTAILSNEKYRGVRLLLENDNLQVVA 295

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A ES+ V +    ++I FN  YL +++  +      DD  +   D+++S+V  
Sbjct: 296 NNPEQEQAEESIGVEFQGEMLEIGFNVSYLQDVLSVLDG----DDMKMTLADANSSAVME 351

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +  DS           YV+MPMR+
Sbjct: 352 EVEGGDS----------LYVVMPMRL 367


>gi|320157815|ref|YP_004190194.1| DNA polymerase III subunit beta [Vibrio vulnificus MO6-24/O]
 gi|319933127|gb|ADV87991.1| DNA polymerase III beta subunit [Vibrio vulnificus MO6-24/O]
          Length = 366

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 120/386 (31%), Positives = 213/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ RS  ++ L      +  + T+P+  ++L+   +G L + A+  E+E+   +   
Sbjct: 1   MKFTIARSHFIKPLQQVSGALGGRPTLPILGNLLINVENGQLSMTATDLEVELISKVTLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   GSITV +    DI R L D A I+F  E   G  V +  G S F L + P ++FP
Sbjct: 61  GEFEAGSITVPSRKFLDICRGLPDDAVITFVLE---GDRVQVRSGRSRFSLATLPANDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +      L    L+ L+E+T F+MA +++RYYLNG+ F I    L+  +VATDGH
Sbjct: 118 NIEDWQSEVEVSLTQGELRALIEKTQFSMANQDVRYYLNGMLFEIEGSTLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AVA+  + A  A+   IIVPRK V E++++L + +  V + +  S +   +     + 
Sbjct: 176 RMAVAQAALSADFAQ-KQIIVPRKGVQELVKLLDTPEQPVTLQIGSSNLRAEVNHFVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P    K L  +C  LRQA  R +I+S+ + + V+++L+  ++ +T 
Sbjct: 235 KLVDGRFPDYRRVLPQHTTKTLEASCDELRQAFSRAAILSNEKFRGVRVNLAGSEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V +    ++I FN  Y+L++++ +       ++V   +  +N+S  +
Sbjct: 295 NNPEQEEAEEMLDVSFEGEAIEIGFNVSYVLDVLNTLRC-----EQVRISMSDANASALV 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              D DS         A YV+MP+R+
Sbjct: 350 ENVDDDS---------AMYVVMPIRL 366


>gi|291615642|ref|YP_003518384.1| DnaN [Pantoea ananatis LMG 20103]
 gi|291150672|gb|ADD75256.1| DnaN [Pantoea ananatis LMG 20103]
          Length = 407

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 129/386 (33%), Positives = 214/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK  VER  +L+ L      +  + T+P+  ++L+Q N+G L +  +  E+E+   +   
Sbjct: 42  MKFIVEREQLLKPLQQVSGPLGGRPTLPILGNLLMQVNEGSLLLTGTDLEMEMVARVALT 101

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A    DI R L +GA+I+   E E    + +  G S F L + P S+FP
Sbjct: 102 QPHETGATTVPARKFLDICRGLPEGAEINVTLEGE---RMLVRSGRSRFSLSTLPASDFP 158

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 159 NLDDWQNEVEFTLPQATLKRLIEATQFSMAHQDVRYYLNGMMFETEGEELR--TVATDGH 216

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E+LR+L   D+ ++V +  S I  ++     + 
Sbjct: 217 RLAVCSMPI-GQALPSHSVIVPRKGVIELLRLLDGGDTPLQVQIGSSNIRAHVGDYIFTS 275

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L ++ ++L +T 
Sbjct: 276 KLVDGRFPDYRRVLPKNPDKALEAGCDLLKQAFARAAILSNEKFRGVRLHITENQLKITA 335

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    ++I FN  Y+L++++ +  + V       RL  ++S   +
Sbjct: 336 NNPEQEEAEEMLDVSYTGSELEIGFNVSYVLDVLNALKCENV-------RLLLTDSVSSV 388

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +D  S         A YV+MPMR+
Sbjct: 389 QIEDVVSP-------AAAYVVMPMRL 407


>gi|327395908|dbj|BAK13330.1| DNA polymerase III beta subunit DnaN [Pantoea ananatis AJ13355]
          Length = 366

 Score =  217 bits (553), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 129/386 (33%), Positives = 215/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  VER  +L+ L      +  + T+P+  ++L+Q N+G L +  +  E+E+   +  +
Sbjct: 1   MKFIVEREQLLKPLQQVSGPLGGRPTLPILGNLLMQVNEGSLLLTGTDLEMEMVARVALT 60

Query: 61  -VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A    DI R L +GA+I+   E E    + +  G S F L + P S+FP
Sbjct: 61  QPHETGATTVPARKFLDICRGLPEGAEINVTLEGE---RMLVRSGRSRFSLSTLPASDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQNEVEFTLPQATLKRLIEATQFSMAHQDVRYYLNGMMFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E+LR+L   D+ ++V +  S I  ++     + 
Sbjct: 176 RLAVCSMPI-GQALPSHSVIVPRKGVIELLRLLDGGDTPLQVQIGSSNIRAHVGDYIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L ++ ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKALEAGCDLLKQAFARAAILSNEKFRGVRLHITENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    ++I FN  Y+L++++ +  + V       RL  ++S   +
Sbjct: 295 NNPEQEEAEEMLDVSYTGSELEIGFNVSYVLDVLNALKCENV-------RLLLTDSVSSV 347

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +D  S         A YV+MPMR+
Sbjct: 348 QIEDVVSP-------AAAYVVMPMRL 366


>gi|145597326|ref|YP_001161401.1| DNA polymerase III subunit beta [Yersinia pestis Pestoides F]
 gi|145209022|gb|ABP38429.1| DNA polymerase III, beta subunit [Yersinia pestis Pestoides F]
          Length = 366

 Score =  217 bits (553), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 126/386 (32%), Positives = 216/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  +ER  +L+ L      +  + T+P+  ++LLQ  +G L +  +  E+E+   +  S
Sbjct: 1   MKFIIEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVTEGSLRLTGTDLEMEMVACVALS 60

Query: 61  VD-VCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   +   G  + +  G S F L + P  +FP
Sbjct: 61  QSHEPGATTVPARKFFDIWRGLPEGAEITVALD---GDRLLVRSGRSRFSLSTLPAIDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + 
Sbjct: 176 RLAVCSMPI-GQTLPSHSVIVPRKGVMELVRLLDGGDTPLRLQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKMLEAGCDLLKQAFSRAAILSNEKFRGVRLYVSHNQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ +  ++V       RL  ++S   +
Sbjct: 295 NNPEQEEAEEILDVSYEGTEMEIGFNVSYVLDVLNALKCEDV-------RLLLTDSVSSV 347

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +D  S+        A YV+MPMR+
Sbjct: 348 QIEDSASQ-------VAAYVVMPMRL 366


>gi|27364432|ref|NP_759960.1| DNA polymerase III subunit beta [Vibrio vulnificus CMCP6]
 gi|27360551|gb|AAO09487.1| DNA polymerase III, beta subunit [Vibrio vulnificus CMCP6]
          Length = 366

 Score =  217 bits (553), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 120/386 (31%), Positives = 213/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ RS  ++ L      +  + T+P+  ++L+   +G L + A+  E+E+   +   
Sbjct: 1   MKFTIARSHFIKPLQQVSGALGGRPTLPILGNLLINVENGQLSMTATDLEVELISKVTLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   GSITV +    DI R L D A I+F  E   G  V +  G S F L + P ++FP
Sbjct: 61  GEFEAGSITVPSRKFIDICRGLPDDAVITFVLE---GDRVQVRSGRSRFSLATLPANDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +      L    L+ L+E+T F+MA +++RYYLNG+ F I    L+  +VATDGH
Sbjct: 118 NIEDWQSEVEVSLTQGELRALIEKTQFSMANQDVRYYLNGMLFEIEGSTLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AVA+  + A  A+   IIVPRK V E++++L + +  V + +  S +   +     + 
Sbjct: 176 RMAVAQAALSADFAQ-KQIIVPRKGVQELVKLLDTPEQPVTLQIGSSNLRAEVNHFVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P    K L  +C  LRQA  R +I+S+ + + V+++L+  ++ +T 
Sbjct: 235 KLVDGRFPDYRRVLPQHTTKTLEASCDELRQAFSRAAILSNEKFRGVRVNLAGSEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V +    ++I FN  Y+L++++ +       ++V   +  +N+S  +
Sbjct: 295 NNPEQEEAEEMLDVSFEGEAIEIGFNVSYVLDVLNTLRC-----EQVRISMSDANASALV 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              D DS         A YV+MP+R+
Sbjct: 350 ENVDDDS---------AMYVVMPIRL 366


>gi|238754005|ref|ZP_04615364.1| DNA polymerase III subunit beta [Yersinia ruckeri ATCC 29473]
 gi|238707757|gb|EEQ00116.1| DNA polymerase III subunit beta [Yersinia ruckeri ATCC 29473]
          Length = 366

 Score =  217 bits (553), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 129/386 (33%), Positives = 216/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  +ER  +L+ L      +  + T+P+  ++LLQ  +G L +  +  E+E+   +  S
Sbjct: 1   MKFIIEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVTEGSLLLTGTDLEMEMVARVTLS 60

Query: 61  -VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   +   G  + +  G S F L + P ++FP
Sbjct: 61  HPHEQGATTVPARKFFDIWRGLPEGAEITVALD---GDRLLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFMLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + 
Sbjct: 176 RLAVCSMPI-GQSLPSHSVIVPRKGVMELVRLLDGGDTPLRLQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLEAGCDLLKQAFARAAILSNEKFRGVRLYVSHNQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ +       ++V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVSYEGTEMEIGFNVSYVLDVLNTLKC-----EDVRLLLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
               +DS +       A YV+MPMR+
Sbjct: 350 ----EDSASQA-----AAYVVMPMRL 366


>gi|145297126|ref|YP_001139967.1| DNA polymerase III beta-subunit [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142849898|gb|ABO88219.1| DNA polymerase III beta-subunit [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 367

 Score =  217 bits (552), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 129/386 (33%), Positives = 215/386 (55%), Gaps = 20/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++ + R  +L  L      +  + T+P+  +VLL  + GLL +  +  E+E+ G +  +
Sbjct: 1   MQLEISREALLRPLQLVSGALGGRPTLPILGNVLLDVSQGLLSLTGTDLEVEMIGQVYLN 60

Query: 61  VDVC-GSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   G  TV A  L DI R L +GA I    E   G  + I  G S F L + P SE+P
Sbjct: 61  NESQDGRTTVPARKLLDICRGLPEGADIRLNTE---GERLIIRSGRSRFNLSTLPASEYP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ E V  F++    LK L++ T F+MA++++RYYLNG+ F    E   L  VATDGH
Sbjct: 118 NIEDWESVLEFDIGQLELKKLIDATQFSMASQDVRYYLNGMLFE--SEGHGLRTVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA    ++V +      +I+PRK V E++R+L ++D  V++ +  S +   ++    + 
Sbjct: 176 RLATCRREVVEESLPDHQVILPRKGVLELVRLLEAEDKPVRLQIGRSNLRAALDGFIFTS 235

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+++ VIP ++DK L     +LRQA  R +I+S+ + + V+L+L  + L +T 
Sbjct: 236 KLVDGRFPDWRRVIPRNSDKALIAGREDLRQAFARAAILSNEKFRGVRLNLQENLLRITA 295

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    M+I FN  Y+L++++ +       D++   L  S SS  I
Sbjct: 296 NNPEQEEAEELLDVQYEASEMEIGFNVSYVLDVLNTLKC-----DQIRISLSDSISSAII 350

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D D +       +A YV+MPMRI
Sbjct: 351 --EDFDHQ-------DAQYVVMPMRI 367


>gi|262273131|ref|ZP_06050948.1| DNA polymerase III beta subunit [Grimontia hollisae CIP 101886]
 gi|262222887|gb|EEY74195.1| DNA polymerase III beta subunit [Grimontia hollisae CIP 101886]
          Length = 366

 Score =  216 bits (551), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 123/386 (31%), Positives = 213/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK TV R   L+ L      +  + T+P+  ++LL+   G L +  +  E+E+   +P  
Sbjct: 1   MKFTVTRDQFLKPLQQVSGALGGRPTLPILGNILLKVESGQLSMTCTDLEVELIANLPLE 60

Query: 61  VDVC-GSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   G++TV +    DI R L D A ISF  E   G    I  G S F L + P ++FP
Sbjct: 61  SEAQEGAVTVPSRKFLDICRGLPDSASISFSLE---GDRAVIRSGRSRFTLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +    F L    L+ L+E T F+MA +++RY+LNG+      E   L +VATDGH
Sbjct: 118 NIEDWQSTVEFTLPQGKLRQLMESTAFSMANQDVRYFLNGMLLET--EGTTLRSVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AV    +  ++A    +IVPRK V E++R+L + D+ V + +  + I   +     + 
Sbjct: 176 RMAVGTTLLDNELAAQ-QVIVPRKGVTELMRMLDNPDAPVTIQIGSANIRALVNQFVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P S++K +   C +LRQA  R +I+S+ + + V+L+LS+ +L ++ 
Sbjct: 235 KLVDGRFPDYRRVLPQSSNKIMEAGCDDLRQAFSRAAILSNEKFRGVRLNLSAGQLRISA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
            NP+  +A E ++V Y+   ++I FN  Y+L++++ + S     ++V F +    +S  +
Sbjct: 295 HNPEQEEAEEFVDVNYDGDDLEIGFNVSYVLDVLNTLKS-----EQVRFSMTDGTASTLV 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
                +  NN D    A YV+MP+R+
Sbjct: 350 -----EDCNNDD----AMYVVMPIRL 366


>gi|90413731|ref|ZP_01221719.1| DNA polymerase III subunit beta [Photobacterium profundum 3TCK]
 gi|90325200|gb|EAS41697.1| DNA polymerase III subunit beta [Photobacterium profundum 3TCK]
          Length = 366

 Score =  216 bits (551), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 119/386 (30%), Positives = 220/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK TVER  +L+ L      +  + ++P+  ++LL+  +G L +  +  E+E+   +   
Sbjct: 1   MKFTVEREHLLKPLQQVSGALGGRPSLPILGNILLKVEEGYLSMTGTDLEVELIAKLALE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D   G++TV +    DI R L D A+I+   E   G  + I  G S + L + P ++FP
Sbjct: 61  ADFEIGAVTVPSRKFLDICRGLPDSAKIAVTLE---GDRILIRSGRSRYSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +    F L    +  L++ T F+MA +++RYYLNG+ F  +   L+  +VATDGH
Sbjct: 118 NIEDWQSEVEFTLPQGRMSQLIQSTQFSMAHQDVRYYLNGMLFETDGSHLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AV  +D+  ++A    IIVPRK V E++R+L + ++ V + +  S I   + +   + 
Sbjct: 176 RMAVCAIDLAQELAT-KQIIVPRKGVLELVRLLDNAEAMVDIQIGNSNIRATVNNFVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P S++K +  +C  LR+A  R +I+S+ + + V+++LS  ++ +T 
Sbjct: 235 KLVDGRFPDYRRVMPQSSNKFVEASCDELRKAFSRAAILSNEKFRGVRVNLSKGEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    ++I FN  Y+L++++ +       D+V   L  +N+S  +
Sbjct: 295 NNPEQEEAEEFLDVDYQGDDLEIGFNVSYVLDVLNTLKC-----DQVRLSLTDANASALV 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
               +D  N++     A YV+MP+R+
Sbjct: 350 ----EDCANDE-----AMYVVMPIRL 366


>gi|285016823|ref|YP_003374534.1| DNA polymerase III subunit beta protein [Xanthomonas albilineans
           GPE PC73]
 gi|283472041|emb|CBA14548.1| probable dna polymerase III subunit beta protein [Xanthomonas
           albilineans]
          Length = 366

 Score =  216 bits (550), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 122/385 (31%), Positives = 215/385 (55%), Gaps = 19/385 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ T++R   L+ L     ++ER+ T+PV  + L+Q + G L +  +  E+E+   I   
Sbjct: 1   MRFTLQREAFLKPLAQVVNVVERRQTLPVLANFLVQVHGGQLSLTGTDLEVEMVSRIAVD 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               G  T+ A  L++IVR L DG++++    N+   ++ +  G S F L + P ++FPS
Sbjct: 61  DAQDGETTIPARKLFEIVRALPDGSKVTVSLSND---KITVQTGRSRFTLATLPANDFPS 117

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
             E E      +  + LK L+ERT FAMA +++RYYLNG+ F ++++ L+ C VATDGHR
Sbjct: 118 VDEVETTERVVVQEAALKELIERTAFAMAQQDVRYYLNGLLFDLHDKTLR-C-VATDGHR 175

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LA+ E ++         IIVPRK V E+ R+L   D  V++ +  S + +    ++ + +
Sbjct: 176 LALCETELENAGGAKRQIIVPRKGVTELQRLLEGGDREVELEVGRSHVRVKRNDVTFTSK 235

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDG FP+Y+ VIP   D+E++++   LR A+ R +I+S+ + + V++ +S  +L ++  
Sbjct: 236 LIDGRFPDYETVIPIGADREVKLDREILRAALQRAAILSNEKYRGVRVEVSPGQLKISAH 295

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           NP+  +A E +        + I FN  YLL+ +  +      ++ VV +L  +NSS  +R
Sbjct: 296 NPEQEEAQEEVEADTKVSDLAIGFNVNYLLDALSALR-----EEFVVIQLRDANSSALVR 350

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
                    + +   + +V+MP+R+
Sbjct: 351 ---------EASSARSRHVVMPLRL 366


>gi|166709897|ref|ZP_02241104.1| DNA polymerase III subunit beta [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 366

 Score =  216 bits (550), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 124/385 (32%), Positives = 217/385 (56%), Gaps = 19/385 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ T++R   L+ L     ++ER+ T+PV  ++L+Q  DG + +  +  E+E+       
Sbjct: 1   MRFTLQREAFLKPLAQVVNVVERRQTLPVLANLLVQVKDGQVSLTGTDLEVEMISRTMVE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               G  T+ A  L+DI+R L DG++++    ++ G +V +  G S F L + P ++FPS
Sbjct: 61  DAQDGETTIPARKLFDILRALPDGSRVTI---SQTGDKVTVQAGRSRFTLVTLPSNDFPS 117

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
             E E      +  + LK L+ERT FAMA +++RYYLNG+ F + +  L+ C VATDGHR
Sbjct: 118 VDEVEATERVVVPEAGLKELIERTAFAMAQQDVRYYLNGLLFDLRDGLLR-C-VATDGHR 175

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LA+ E+++         IIVPRK V E+ R+L   D  V++ +  S I +    ++ + +
Sbjct: 176 LALCEMELENAGGAKRQIIVPRKGVTELQRLLEGADREVELEVGRSHIRVKRGDVTFTSK 235

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDG FP+Y+ V+P   D+E++V+   LR ++ R +I+S+ + + V++ +S  +L ++  
Sbjct: 236 LIDGRFPDYEAVMPIGADREVKVDREALRASLQRAAILSNEKYRGVRVEVSPGQLKISAH 295

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           NP+  +A E +        + I FN  YLL+ +  +      D+ VV +L  +NSS  +R
Sbjct: 296 NPEQEEAQEEIEADTKVDDLAIGFNVNYLLDALSALR-----DEHVVIQLRDANSSALVR 350

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
             +  S+ ++       +V+MP+R+
Sbjct: 351 --EASSEKSR-------HVVMPLRL 366


>gi|87121028|ref|ZP_01076920.1| DNA polymerase III, beta chain [Marinomonas sp. MED121]
 gi|86163866|gb|EAQ65139.1| DNA polymerase III, beta chain [Marinomonas sp. MED121]
          Length = 365

 Score =  216 bits (549), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 137/388 (35%), Positives = 217/388 (55%), Gaps = 26/388 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK +V R  +L+ L     ++ERK T+PV  +VLL+  D  L +  S  E+E+ G I   
Sbjct: 1   MKFSVVRETLLKPLQLVAGVVERKQTMPVLANVLLEVKDNELTLTGSDLEVELVGHI--Q 58

Query: 61  VDVC--GSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEF 118
           +D C  G ITV A  L DI + L D A I    ++   T   I  G S F L + P  EF
Sbjct: 59  LDECQEGRITVPARKLMDICKSLPDSAVIELSVDD---TRAIIRSGRSRFTLSTLPADEF 115

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P+ ++ +   S  +A + ++ L+ERT FAMA +++RYYLNG+ F +   D +L  V+TDG
Sbjct: 116 PNIQDMQGDLSVVVAQNSVRRLIERTGFAMANQDVRYYLNGMLFEV--ADGQLRVVSTDG 173

Query: 179 HRLAVAEVDIVAQIAK-MPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           HRLA A  D  AQ++  +  +IVPRK V E+ R+LS  D +V++ +  + I   +     
Sbjct: 174 HRLATAIED--AQVSGDLTQVIVPRKGVLELNRLLSDTDETVELQIGANHIRAKVADYIF 231

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +L++G+FP+Y  VIP +NDK +  +   LRQ   R SI+S+ + + V+L L++  L +
Sbjct: 232 TSKLVEGKFPDYHRVIPRNNDKIVIADRLELRQVFLRASILSNEKYRGVRLILTNGMLQV 291

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
             +NP+  +A ES+ V Y    +++ FN  YLL+++  ++S      EV   L+ + +S 
Sbjct: 292 FANNPEQEEAEESVLVQYQGDDLEVGFNVSYLLDVLGVVNS-----QEVRISLNDATASA 346

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            +   D  +         A YV+MPMR+
Sbjct: 347 LVEEADSHA---------AQYVVMPMRL 365


>gi|330813296|ref|YP_004357535.1| DNA polymerase III beta subunit [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486391|gb|AEA80796.1| DNA polymerase III beta subunit [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 371

 Score =  215 bits (548), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 132/388 (34%), Positives = 222/388 (57%), Gaps = 21/388 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+I ++R  IL+ L H   ++E+KNT+P+  +VL++A D  ++I A+  +I IT  I A 
Sbjct: 1   MEIKIDRDIILKCLNHIQGVVEKKNTLPILANVLIEAFDNKIQISATDLDIIITEKIDAD 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V   GS T +A +LYD++RKL  G+ I    +N+    + +  G S+F L   P SEFP 
Sbjct: 61  VIKEGSTTTTAQVLYDLIRKLPAGSGIHLNLQND--KRLKLISGKSDFNLTCLPASEFPI 118

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEED-LKLCAVATDGH 179
            ++       E+ S  L  L+ +T F+++ +E R+YLNGI+ H  EED  KL AVATDGH
Sbjct: 119 LEDSIESDYLEVKSKYLLKLLNKTKFSISNDETRHYLNGIYLHKPEEDNSKLIAVATDGH 178

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSK-DSSVKVSLSESRIHLNIESLSMS 238
           RL+  ++  V +  K   +I+P+K + EI+ I+S + D+ +K+    S+I   I+ + + 
Sbjct: 179 RLSKTQI-TVDENKKFHPVILPKKTIFEIINIISDEPDTPIKILSVRSKIKFIIKDIVLI 237

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            ++IDG+FP+Y+ VIP    KE+  N  +   AVDR+  +S+ R   +K+++ + K+   
Sbjct: 238 SKVIDGKFPDYEKVIPSDTRKEVLANVADFISAVDRIKSLSADRKGVIKINIENHKIRFF 297

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           +++   G+ IE ++  Y    ++I FN  YL++I + I      D+ +  +   + S + 
Sbjct: 298 INDTSSGEGIEEISAVYEGDNLEIGFNSGYLMDIANCIQ-----DENITLKPKDATSPII 352

Query: 359 IRG-KDKDSKNNKDNKVNAFYVLMPMRI 385
           I+  KD DS           YV+MPMR+
Sbjct: 353 IKDQKDPDST----------YVVMPMRV 370


>gi|257097208|pdb|3F1V|A Chain A, E. Coli Beta Sliding Clamp, 148-153 Ala Mutant
 gi|257097209|pdb|3F1V|B Chain B, E. Coli Beta Sliding Clamp, 148-153 Ala Mutant
          Length = 366

 Score =  215 bits (548), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 131/386 (33%), Positives = 213/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +   
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALV 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E E    + +  G S F L + P ++FP
Sbjct: 61  QPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGE---RMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA     YYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAAAAAAYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E++R+L   D+ ++V +  + I  ++     + 
Sbjct: 176 RLAVCSMPI-GQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +I+S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y+   M+I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVTYSGAEMEIGFNVSYVLDVLNALKC-----ENVRMMLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       +A YV+MPMR+
Sbjct: 350 --EDAASQ-------SAAYVVMPMRL 366


>gi|253686411|ref|YP_003015601.1| DNA polymerase III, beta subunit [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251752989|gb|ACT11065.1| DNA polymerase III, beta subunit [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 366

 Score =  215 bits (547), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 124/386 (32%), Positives = 216/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK  VER  +L+ L      +  + T+P+  ++L+Q  +  L +  +  E+E+   +   
Sbjct: 1   MKFIVERERLLKPLQQVSSPLGGRPTLPILGNLLIQVTEDALSLTGTDLEMEMVAKVALT 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A  L+DI R L +GA+I+   +   G  + +  G S F L + P ++FP
Sbjct: 61  QPHEPGATTVPARKLFDICRGLPEGAEITIMLD---GDRMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSDVEFSLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  +  V Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + 
Sbjct: 176 RLAVCSMP-VGQSLPSHSVIVPRKGVMELVRLLDGGDTPLQLQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L  +C  L+QA  R +I+S+ + + V+L L  ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKTLEASCDLLKQAFSRAAILSNEKFRGVRLHLIQNQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y+   M+I FN  Y+L++++ +  + V       RL  ++S   +
Sbjct: 295 NNPEQEEAEEILDVQYDGTEMEIGFNVSYVLDVLNALKCEGV-------RLLLTDSVSSV 347

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           + +D  S+        A YV+MPMR+
Sbjct: 348 QIEDSASR-------AAAYVVMPMRL 366


>gi|330970326|gb|EGH70392.1| DNA polymerase III subunit beta [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 367

 Score =  215 bits (547), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 127/389 (32%), Positives = 218/389 (56%), Gaps = 26/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAI--- 57
           M  T++R  +L+ L     ++ER+ T+PV  +VLL      L +  +  E+E+ G +   
Sbjct: 1   MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLTGTDLEVELVGRVQLE 60

Query: 58  -PASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPES 116
            PA     G ITV A  L DI + L + A I    ++   +++ +  G S F L + P +
Sbjct: 61  EPAE---PGEITVPARKLMDICKSLSNDALIDIKLDD---SKLIVKAGRSRFTLSTLPSN 114

Query: 117 EFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVAT 176
           +FP+ +E     +F L  S L+ L+ERT FAMA +++RYYLNG+   ++   L+  AVAT
Sbjct: 115 DFPTVEEGPGSLTFTLVQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVSAGILR--AVAT 172

Query: 177 DGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLS 236
           DGHRLA+  +    + A    +IVPRK + E+ R+L+ +D +V + L +  I       +
Sbjct: 173 DGHRLAMCSMSADIEHADRHQVIVPRKGILEMARLLTEQDGTVSIVLGQHHIRATTGEFT 232

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
            + +L+DG+FP+Y+ V+P   DK +  +   LR+A  R +I+S+ + + ++L L+S +L 
Sbjct: 233 FTSKLVDGKFPDYERVLPKGGDKLVLGDRQALREAFSRTAILSNEKYRGIRLQLASGQLK 292

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           +  +NP+  +A E ++V YN   ++I FN  YLL+++  +++     ++V   L  SNSS
Sbjct: 293 IQANNPEQEEAEEEISVEYNGDSLEIGFNVSYLLDVLGVMTT-----EQVRLILSDSNSS 347

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             ++  D D         ++ YV+MPMR+
Sbjct: 348 ALVQESDND---------DSAYVVMPMRL 367


>gi|66043273|ref|YP_233114.1| DNA polymerase III subunit beta [Pseudomonas syringae pv. syringae
           B728a]
 gi|302185841|ref|ZP_07262514.1| DNA polymerase III subunit beta [Pseudomonas syringae pv. syringae
           642]
 gi|63253980|gb|AAY35076.1| DNA polymerase III, beta chain [Pseudomonas syringae pv. syringae
           B728a]
 gi|330976403|gb|EGH76460.1| DNA polymerase III subunit beta [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 367

 Score =  215 bits (547), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 127/389 (32%), Positives = 218/389 (56%), Gaps = 26/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAI--- 57
           M  T++R  +L+ L     ++ER+ T+PV  +VLL      L +  +  E+E+ G +   
Sbjct: 1   MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLTGTDLEVELVGRVQLE 60

Query: 58  -PASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPES 116
            PA     G ITV A  L DI + L + A I    ++   +++ +  G S F L + P +
Sbjct: 61  EPAE---PGEITVPARKLMDICKSLSNDALIDIKLDD---SKLIVKAGRSRFTLSTLPAN 114

Query: 117 EFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVAT 176
           +FP+ +E     +F L  S L+ L+ERT FAMA +++RYYLNG+   ++   L+  AVAT
Sbjct: 115 DFPTVEEGPGSLTFTLVQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVSAGILR--AVAT 172

Query: 177 DGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLS 236
           DGHRLA+  +    + A    +IVPRK + E+ R+L+ +D +V + L +  I       +
Sbjct: 173 DGHRLAMCSMSADIEHADRHQVIVPRKGILEMARLLTEQDGTVSIVLGQHHIRATTGEFT 232

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
            + +L+DG+FP+Y+ V+P   DK +  +   LR+A  R +I+S+ + + ++L L+S +L 
Sbjct: 233 FTSKLVDGKFPDYERVLPKGGDKLVLGDRQALREAFSRTAILSNEKYRGIRLQLASGQLK 292

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           +  +NP+  +A E ++V YN   ++I FN  YLL+++  +++     ++V   L  SNSS
Sbjct: 293 IQANNPEQEEAEEEISVEYNGDSLEIGFNVSYLLDVLGVMTT-----EQVRLILSDSNSS 347

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             ++  D D         ++ YV+MPMR+
Sbjct: 348 ALVQESDND---------DSAYVVMPMRL 367


>gi|90415377|ref|ZP_01223311.1| DNA polymerase III, beta subunit [marine gamma proteobacterium
           HTCC2207]
 gi|90332700|gb|EAS47870.1| DNA polymerase III, beta subunit [marine gamma proteobacterium
           HTCC2207]
          Length = 366

 Score =  214 bits (546), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 128/386 (33%), Positives = 215/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITG-AIPA 59
           MK ++ R  +L  L     ++ER+ T+P+  +VLL  +   L +  +  E+EI G A   
Sbjct: 1   MKFSLSREALLNPLQLVVGVVERRQTLPILSNVLLTLDGSRLAVTGTDLEVEIIGHADVV 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
           S D  G +TVSA    DI R L +GA I F   +    +  +  G S F L + P +EFP
Sbjct: 61  SADEAGEVTVSARKFLDICRSLPEGANIKFSSSD---GKAQVVSGRSRFTLATLPANEFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           S    E    F++A  +LKNL++ T FAMA +++RYYLNG+ + ++    KL AVATDGH
Sbjct: 118 SVDNGENNIQFDIAGVILKNLIDATSFAMAQQDVRYYLNGMLWEVSAN--KLRAVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+A+ + +   +I ++   I+PRK V E+ R+++  +  V+V++  + I ++      + 
Sbjct: 176 RMALCDAECNIEIGELTKAILPRKGVIELSRLVAD-EGVVRVAMGSNHIRVDGSDYCFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG +P+Y  V+P   DK +  N   L+QA  R +I+S+ + + V++ LS+  + M  
Sbjct: 235 KLVDGAYPDYDRVLPKGGDKLVEGNRAELKQAFGRTAILSNEKYRGVRIMLSNGAIKMVA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E + V Y    ++I FN  YLL++++ +       D V   L  S+SS  +
Sbjct: 295 NNPEQEEAEEEVGVDYAGDELEIGFNVSYLLDVLNVLKG-----DGVRLTLSDSSSSALV 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
               +D+ +      +A YV+MPMR+
Sbjct: 350 ----EDAADG-----SAVYVVMPMRL 366


>gi|163751708|ref|ZP_02158927.1| DNA polymerase III, beta subunit [Shewanella benthica KT99]
 gi|161328447|gb|EDP99603.1| DNA polymerase III, beta subunit [Shewanella benthica KT99]
          Length = 366

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 126/387 (32%), Positives = 218/387 (56%), Gaps = 23/387 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK +++R  +L+ L      +ER++ +P+  ++L++ +   L++  +  E+E+ G +   
Sbjct: 1   MKFSIDRDALLKPLQLVNGAVERRHNLPILANLLVEVSGHTLKMTGTDLEVELVGQVQLE 60

Query: 61  VDVC-GSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESEF 118
            DV  G  T+ A    DIV+ L D  +I    +EN L     +  G S F L + P  E+
Sbjct: 61  GDVEEGRTTIPAKKFLDIVKSLPDQVEIKIEQQENRLL----LRSGRSRFTLATLPAEEY 116

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P+ +  E    F +   +LK+L++ T F+MA +++RYYLNG+    +   L+  A+ATDG
Sbjct: 117 PNVEAFESDIEFTIKQGILKSLIDATQFSMANQDVRYYLNGLLLETDGNVLR--AIATDG 174

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA++   I A + K   +IVPRK V E+ R+   +D  V +++ ++ I     S  ++
Sbjct: 175 HRLALSHRKIEANLPK-KQVIVPRKGVVELQRLYEGEDLDVTIAIGDNAIRATTSSAVLT 233

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y+ V+P   DK +  +   L+QA+ R SI+S+ + + V++ L ++ L +T
Sbjct: 234 SKLIDGRFPDYRRVLPKGGDKIVIASRNQLKQALLRASILSNEKFRGVRVQLENNLLKIT 293

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
            +NP+  +A E ++V Y+  P++I FN  YLL++++N+ S     DEV   L   NSS  
Sbjct: 294 ANNPEQEEAEEIIDVEYDNTPLEIGFNVSYLLDVLNNLPS-----DEVRITLIDGNSSAL 348

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           I    ++         N+ YV+MPMR+
Sbjct: 349 IENHIEE---------NSMYVVMPMRL 366


>gi|237806778|ref|YP_002891218.1| DNA polymerase III, beta subunit [Tolumonas auensis DSM 9187]
 gi|237499039|gb|ACQ91632.1| DNA polymerase III, beta subunit [Tolumonas auensis DSM 9187]
          Length = 367

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 120/386 (31%), Positives = 217/386 (56%), Gaps = 20/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           M+ ++ R  +L  L      I  + T+P+  +VLL   +  L +  +  E+E+ G +P A
Sbjct: 1   MQFSISRDSLLRPLQLVSGSIGGRPTLPILSNVLLNVTEQRLSLTGTDLEVEMIGLVPLA 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                GSIT  A  L DI R L DGAQ+ F  E   G  + +  G S + L + P +++P
Sbjct: 61  GAVAVGSITTPARKLLDICRGLPDGAQLDFVLE---GERLILRSGRSRYSLSTLPAADYP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + +E   V  F+++   LK L+E T F+MA++++R+YLNG+ F  + + L+   V TDGH
Sbjct: 118 NIEEWNSVLEFDISQQELKRLMEATQFSMASQDVRFYLNGMLFETSGQGLR--TVGTDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA    +++ +      +I+PRK V E+ R+L + D ++++ +  + +    E    + 
Sbjct: 176 RLATCRREVLNEPQSDHQVILPRKGVLELARLLENDDRTIRLQIGLNNLRAEAEGFIFTS 235

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V P  +DK L      L+QA  R +I+S+ + + V+L L+++ L +T 
Sbjct: 236 KLVDGRFPDYRRVFPRQSDKILIAERELLKQAFSRAAILSNEKFRGVRLHLTTNLLHITA 295

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y+   +++ FN  Y+L++++ +       ++V + L  +NSS  +
Sbjct: 296 NNPEQEEAEELIDVQYDGPELEVGFNVSYVLDVLNALKC-----EQVKWYLTDANSSALV 350

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
               +D+ N+     +A YV+MPMR+
Sbjct: 351 ----EDASND-----DAQYVVMPMRL 367


>gi|92112138|ref|YP_572066.1| DNA polymerase III subunit beta [Chromohalobacter salexigens DSM
           3043]
 gi|91795228|gb|ABE57367.1| DNA polymerase III, beta subunit [Chromohalobacter salexigens DSM
           3043]
          Length = 367

 Score =  214 bits (545), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 123/386 (31%), Positives = 205/386 (53%), Gaps = 20/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITG-AIPA 59
           M+ T+ R  +L  L     ++ER+ T+PV  +VLLQ  D  L +  +  E+E+ G   P 
Sbjct: 1   MRFTITREALLRPLSLVAGVVERRQTLPVLSNVLLQVQDSQLALTGTDLEVELIGRTTPH 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            VD  GS TV A  L DI + L +   I+F  E   G  + +  G S F L + P +EFP
Sbjct: 61  HVDEPGSATVPARKLMDICKSLPEQTDITFTLEE--GRAI-LRAGRSRFTLSTLPVAEFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + +  +   +  LA   LK+L++ T FAMA +++RYYLNG+        ++   VATDGH
Sbjct: 118 NIEGSQSDTTLTLARGTLKHLIDATSFAMAQQDVRYYLNGMLLEFGHHLVR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV       ++     +IVPRK + E+ R+L   D  V++++  + +       + + 
Sbjct: 176 RLAVCARSADVEVEPSQKLIVPRKGILELARLLDGSDEPVELTIGGTHLRAQTGDFTFTS 235

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG+FP+Y  VIP   DK +      LRQ + R +I+S+ + + V+L+L  + L +T 
Sbjct: 236 KLVDGKFPDYDRVIPRGGDKVVIAERGELRQVLSRTAILSNEKYRGVRLNLEENNLRVTA 295

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E++ + Y+   +++ FN  YL++++  + +     D V   L   NSS  +
Sbjct: 296 NNPEQEEAEENVAIEYDGGALEVGFNVGYLVDVLGVLDA-----DRVQMTLSDPNSSALL 350

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
                     +    +A YV+MPMR+
Sbjct: 351 ---------EEPGGGDAMYVVMPMRL 367


>gi|300112747|ref|YP_003759322.1| DNA polymerase III subunit beta [Nitrosococcus watsonii C-113]
 gi|299538684|gb|ADJ27001.1| DNA polymerase III, beta subunit [Nitrosococcus watsonii C-113]
          Length = 367

 Score =  214 bits (545), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 135/388 (34%), Positives = 218/388 (56%), Gaps = 24/388 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ +++R +I+  L   C ++ER++T+P+  +VLL   D  L + A+  EIEI  A    
Sbjct: 1   MRFSIKREEIVRHLVTICGVVERRHTLPILSNVLLSVKDSRLSLMATDLEIEIKTAFDIL 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQI-SFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
               G IT+SA    +I R L   + + + +KE +      I  G S F L + P  +FP
Sbjct: 61  SPEEGKITISARKFLEICRALPSQSALEAQYKEGQF----YIHSGRSRFTLSTLPAEDFP 116

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           S    + V   EL  + LK L+ RT F MA +++RYYLNG+   + EE +   AVATDGH
Sbjct: 117 SIDSIDAVAELELTQAELKKLLYRTVFCMAHQDVRYYLNGLLLELTEEAIH--AVATDGH 174

Query: 180 RLAVAEVDIVAQIAKMP-SIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           RLA+A +   +Q A      I+PRKA+ E++R+L   + SV++    +++    + LS S
Sbjct: 175 RLALASLAKGSQQAGTEIQSIIPRKAILELVRLLEESNDSVRLKFGTNQMRAEFQGLSFS 234

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG+FP+Y+ VIP   +K+   +    +QA+ RV+I+++ + + V L LS+ KL   
Sbjct: 235 TKLIDGQFPDYKRVIPVGCEKQFVADREKFKQALVRVNILTNDKYRGVHLHLSALKLQAI 294

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V N + G A E +++ Y    ++I FN  YL++++  I ++E+   ++ F   ++NSS  
Sbjct: 295 VTNLEQGSAEEELDIKYQGENLEIVFNNFYLIDVLSIIDTEEI---KLTF--TNANSSCL 349

Query: 359 IRGKDK-DSKNNKDNKVNAFYVLMPMRI 385
           I   DK DSK          YV+MPMR+
Sbjct: 350 ITPIDKADSK----------YVVMPMRL 367


>gi|262189752|ref|ZP_06048107.1| DNA polymerase III beta subunit [Vibrio cholerae CT 5369-93]
 gi|262034366|gb|EEY52751.1| DNA polymerase III beta subunit [Vibrio cholerae CT 5369-93]
          Length = 353

 Score =  214 bits (545), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 111/342 (32%), Positives = 199/342 (58%), Gaps = 7/342 (2%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ERS +++ L      +  + ++P+  ++LL+  +  L + A+  E+E+   +   
Sbjct: 1   MKFTIERSHLIKPLQQVSGTLGGRASLPILGNLLLKVEENQLSMTATDLEVELISRVTLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   GSITV A    DI R L D A I+   E   G  + +  G S F L + P S+FP
Sbjct: 61  GEFEAGSITVPARKFLDICRGLPDSAVITVLLE---GDRIQVRSGRSRFSLATLPASDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +      L  + L+ L+E+T F+MA +++RYYLNG+ F I+   L+  +VATDGH
Sbjct: 118 NIEDWQSEVQVSLTQAELRGLIEKTQFSMANQDVRYYLNGMLFEIDGTTLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AVA+  + A  A+   IIVPRK V E++++L + +  V + +  S +   +     + 
Sbjct: 176 RMAVAQAQLGADFAQ-KQIIVPRKGVLELVKLLDAPEQPVVLQIGHSNLRAEVNHFVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P    K L+  C  LRQA  R +I+S+ + + V+++L+ +++ +T 
Sbjct: 235 KLVDGRFPDYRRVLPQHTSKTLQTGCEELRQAFSRAAILSNEKFRGVRVNLADNEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEV 341
           +NP+  +A E ++V +   P++I FN  Y+L++++ +  D V
Sbjct: 295 NNPEQEEAEELLDVSFEGEPIEIGFNVSYILDVLNTLRCDNV 336


>gi|254435596|ref|ZP_05049103.1| DNA polymerase III, beta subunit [Nitrosococcus oceani AFC27]
 gi|207088707|gb|EDZ65979.1| DNA polymerase III, beta subunit [Nitrosococcus oceani AFC27]
          Length = 377

 Score =  214 bits (544), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 132/387 (34%), Positives = 213/387 (55%), Gaps = 22/387 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ +++R +I+  L   C ++ER++T+P+  +VLL   D  L + A+  EIEI  A+   
Sbjct: 11  MRFSIKREEIVRHLVTVCGVVERRHTLPILSNVLLSVKDSQLSLMATDLEIEIRTALKVL 70

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQI-SFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
               G +TVSA    +I R L  G+ + + +KE +      I  G S F L + P  +FP
Sbjct: 71  SSEEGKVTVSARKFLEICRALPSGSALEAQYKEGQF----YIHSGRSRFTLSTLPAEDFP 126

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           S    + V   EL  + LK L+ RT F MA +++RYYLNG+   + EE +   AVATDGH
Sbjct: 127 SIDSIDAVAELELTQAELKQLLHRTVFCMAHQDVRYYLNGLLLELTEESIH--AVATDGH 184

Query: 180 RLAVAEVDIVA-QIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           RLA+A +   A Q       I+PRKA+ E++R+L      V++    +++    + LS S
Sbjct: 185 RLALASLAKGADQEGTEIQSIIPRKAILELVRLLEESQEPVRLKFGTNQMRAEFQGLSFS 244

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG+FP+Y+ VIP   +K+   +    +QA+ RV+I+++ + + V L LS  KL   
Sbjct: 245 TKLIDGQFPDYKRVIPVGCEKQFVADRERFKQALVRVNILTNDKYRGVHLHLSDLKLQAI 304

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V N + G A E +++ Y    ++I FN  YL+++++ I + EV       RL  +N+S  
Sbjct: 305 VTNLEQGSAEEELDIKYQGENLEIVFNNFYLIDVLNIIDTKEV-------RLTFTNASSS 357

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
                 D+ ++K       YV+MPMR+
Sbjct: 358 CLITPIDASDSK-------YVVMPMRL 377


>gi|15988190|pdb|1JQL|A Chain A, Mechanism Of Processivity Clamp Opening By The Delta
           Subunit Wrench Of The Clamp Loader Complex Of E. Coli
           Dna Polymerase Iii: Structure Of Beta-Delta (1-140)
 gi|16974833|pdb|1JQJ|A Chain A, Mechanism Of Processivity Clamp Opening By The Delta
           Subunit Wrench Of The Clamp Loader Complex Of E. Coli
           Dna Polymerase Iii: Structure Of The Beta-Delta Complex
 gi|16974834|pdb|1JQJ|B Chain B, Mechanism Of Processivity Clamp Opening By The Delta
           Subunit Wrench Of The Clamp Loader Complex Of E. Coli
           Dna Polymerase Iii: Structure Of The Beta-Delta Complex
          Length = 366

 Score =  214 bits (544), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 131/386 (33%), Positives = 215/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +   
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALV 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E E    + +  G S F L + P ++FP
Sbjct: 61  QPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGE---RMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + +K L+E T F+MA +++RYYLNG+ F    E+L+   VATDGH
Sbjct: 118 NLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + I  Q     S+IVPRK V E++R+L   D+ ++V +  + I  ++     + 
Sbjct: 176 RLAVCSMPI-GQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L   C  L+QA  R +  S+ + + V+L +S ++L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAAASNEKFRGVRLYVSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y+   M+I FN  Y+L++++ +       + V   L  S SSV I
Sbjct: 295 NNPEQEEAEEILDVTYSGAEMEIGFNVSYVLDVLNALKC-----ENVRMMLTDSVSSVQI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +D  S+       +A YV+MPMR+
Sbjct: 350 --EDAASQ-------SAAYVVMPMRL 366


>gi|209693644|ref|YP_002261572.1| DNA polymerase III subunit beta [Aliivibrio salmonicida LFI1238]
 gi|208007595|emb|CAQ77695.1| DNA polymerase III subunit beta-subunit [Aliivibrio salmonicida
           LFI1238]
          Length = 369

 Score =  214 bits (544), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 119/386 (30%), Positives = 224/386 (58%), Gaps = 18/386 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK ++ERS +L+ L      +  + ++P+  ++LLQ  +G L + A+  E+E+   I   
Sbjct: 1   MKFSIERSHLLKPLQQVSGALGGRPSLPIFGNILLQVENGQLSMTATDLEVELISNILLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D   G+ITV +    DI R L DGA I+   E   G  V +  G S F L + P  +FP
Sbjct: 61  GDFEAGAITVPSRKFLDICRGLPDGANITIVLE---GDRVLVRSGRSRFTLATLPAQDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + +  +      L+ + L+ L+E T F+MA +++RYYLNG+ F       +  +VATDGH
Sbjct: 118 NIEGWQSEVEITLSQAQLRKLIESTQFSMANQDVRYYLNGMMFETQGTIFR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AV  + + +++ +   +I+PRK + E++R+L S + SV +    S +   + +   + 
Sbjct: 176 RMAVCNMPVESELPEQ-QVIMPRKGIQELVRLLDSPEQSVTLQFGNSNVRAEVNNFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P S++K L  +C  LRQA  R +I+S+ + + V+++L+++++ +T 
Sbjct: 235 KLVDGRFPDYRRVMPQSSNKTLEADCDELRQAFARAAILSNEKFRGVRVNLANNQMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V +    ++I FN  Y+L+++D +++ +   + V   + ++N+S  +
Sbjct: 295 NNPEQEEAEEILDVDFQGEDIEIGFNVSYVLDVLDVLNTLKC--ERVRISMTTANASALV 352

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
               +D  N++     A YV+MP+R+
Sbjct: 353 ----EDCANDE-----AQYVVMPIRL 369


>gi|24371609|ref|NP_715651.1| DNA polymerase III, beta subunit [Shewanella oneidensis MR-1]
 gi|24345359|gb|AAN53096.1|AE015452_9 DNA polymerase III, beta subunit [Shewanella oneidensis MR-1]
          Length = 366

 Score =  214 bits (544), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 122/386 (31%), Positives = 223/386 (57%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK +++R  +L+ L   C  +ER++ +P+  ++L++ +   L++  +  E+E+ G     
Sbjct: 1   MKFSIDRDALLKPLQLVCGAVERRHNLPILANLLVEVSGHSLKLTGTDLEVELVGQAVIH 60

Query: 61  VDVC-GSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D+  G  TV A  L DIV+ L + +++   +++    +  +  G S F L + P  E+P
Sbjct: 61  GDIEEGRTTVPAKKLLDIVKSLPEQSELKVEQQD---NKWLLRSGRSRFSLATLPAEEYP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + +  +    F L   VLK+L++ T F+MA +++RYYLNG+   I  E   L A+ATDGH
Sbjct: 118 NVEAFQAEIEFTLKQGVLKSLIDATQFSMANQDVRYYLNGLL--IETEGNMLRAIATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA++   I AQ+ +   +IVPRK V E+ R+L + D  + +S+ ++ I     +   + 
Sbjct: 176 RLALSHRVIEAQLPE-KQVIVPRKGVMEMARLLETDDLDIAISIGDNAIRATTSTTVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P   DK +  +  + +QA+ R SI+S+ + + V++ L +  L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKGGDKIVIASRNHFKQALTRASILSNEKFRGVRIQLEAGLLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V YN  P++I FN  YLL++++N+ SD+V     +  +D ++S++  
Sbjct: 295 NNPEQEEAEEIIDVDYNNLPLEIGFNVSYLLDVLNNLKSDDV----RITLIDGNSSALLE 350

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              ++DS           YV+MPMR+
Sbjct: 351 NHLEEDS----------MYVVMPMRL 366


>gi|77163563|ref|YP_342088.1| DNA-directed DNA polymerase [Nitrosococcus oceani ATCC 19707]
 gi|76881877|gb|ABA56558.1| DNA polymerase III, beta subunit [Nitrosococcus oceani ATCC 19707]
          Length = 367

 Score =  214 bits (544), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 132/387 (34%), Positives = 213/387 (55%), Gaps = 22/387 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ +++R +I+  L   C ++ER++T+P+  +VLL   D  L + A+  EIEI  A+   
Sbjct: 1   MRFSIKREEIVRHLVTVCGVVERRHTLPILSNVLLSVKDSQLSLMATDLEIEIRTALKVL 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQI-SFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
               G +TVSA    +I R L  G+ + + +KE +      I  G S F L + P  +FP
Sbjct: 61  SSEEGKVTVSARKFLEICRALPSGSALEAQYKEGQF----YIHSGRSRFTLSTLPAEDFP 116

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           S    + V   EL  + LK L+ RT F MA +++RYYLNG+   + EE +   AVATDGH
Sbjct: 117 SIDSIDAVAELELTQAELKQLLHRTVFCMAHQDVRYYLNGLLLELTEESIH--AVATDGH 174

Query: 180 RLAVAEVDIVA-QIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           RLA+A +   A Q       I+PRKA+ E++R+L      V++    +++    + LS S
Sbjct: 175 RLALASLAKGADQEGTEIQSIIPRKAILELVRLLEESQEPVRLKFGTNQMRAEFQGLSFS 234

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG+FP+Y+ VIP   +K+   +    +QA+ RV+I+++ + + V L LS  KL   
Sbjct: 235 TKLIDGQFPDYKRVIPVGCEKQFVADRERFKQALVRVNILTNDKYRGVHLHLSDLKLQAI 294

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
           V N + G A E +++ Y    ++I FN  YL+++++ I + EV       RL  +N+S  
Sbjct: 295 VTNLEQGSAEEELDIKYQGENLEIVFNNFYLIDVLNIIDTKEV-------RLTFTNASSS 347

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
                 D+ ++K       YV+MPMR+
Sbjct: 348 CLITPIDASDSK-------YVVMPMRL 367


>gi|74316020|ref|YP_313760.1| DNA polymerase III subunit beta [Thiobacillus denitrificans ATCC
           25259]
 gi|74055515|gb|AAZ95955.1| DNA polymerase III, beta chain [Thiobacillus denitrificans ATCC
           25259]
          Length = 367

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 120/384 (31%), Positives = 218/384 (56%), Gaps = 21/384 (5%)

Query: 3   ITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPASVD 62
           I  ER+ +L  L     ++ER++T+P+  ++LL+   G L + A+  E++++  + A   
Sbjct: 4   IQSERNALLSALSAVVGVVERRHTLPILSNLLLEKKAGTLTLLATDLELQVSTRLEAQGG 63

Query: 63  VCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPSTK 122
              +IT++A  L+DIVR L D A +    ++   ++V +S G S F LQ+ P ++FP  +
Sbjct: 64  DDFAITIAARKLFDIVRALPDSASVKLDTKD---SQVVVSAGKSRFTLQTLPAADFPRVE 120

Query: 123 EEEYVYSF-ELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRL 181
               V +   L    LK L++   FAMA+++IRYYLNG+   ++ + L++  VATDGHRL
Sbjct: 121 TGAGVGTVVRLPQKTLKRLLQLVQFAMASQDIRYYLNGMLLVLDGQQLRV--VATDGHRL 178

Query: 182 AVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRL 241
           + AE  + A       +I+PRK V E+ ++LS  D  V++ +  +++ + +    +  ++
Sbjct: 179 SYAETTLDAP-TDAQEVIIPRKTVIELSKLLSDSDEPVELRIGSNQVTIMLPGTELVTKV 237

Query: 242 IDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDN 301
           +DG+FP+YQ VIP +  + L+ N   + QA+ R +I+S+ + + V+L +S + L +  +N
Sbjct: 238 VDGKFPDYQRVIPANQPRHLKANRQTVVQALQRAAILSNEKFRGVRLVMSDNTLGIVCNN 297

Query: 302 PDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIRG 361
            +  +A + + V YN  P+D+ FN  YLL+ +  +++     DE+   L  +NSS+ +  
Sbjct: 298 NEQEEAADEIEVSYNGDPLDVGFNVTYLLDGLGAVNT-----DEITLSLGDANSSMLL-- 350

Query: 362 KDKDSKNNKDNKVNAFYVLMPMRI 385
                    + +    YV+MPMRI
Sbjct: 351 -------TSEGEPGFKYVVMPMRI 367


>gi|71736736|ref|YP_272317.1| DNA polymerase III subunit beta [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71557289|gb|AAZ36500.1| DNA polymerase III, beta subunit [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|320321689|gb|EFW77788.1| DNA polymerase III subunit beta [Pseudomonas syringae pv. glycinea
           str. B076]
 gi|320331109|gb|EFW87080.1| DNA polymerase III subunit beta [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330881907|gb|EGH16056.1| DNA polymerase III subunit beta [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330952331|gb|EGH52591.1| DNA polymerase III subunit beta [Pseudomonas syringae Cit 7]
 gi|330961506|gb|EGH61766.1| DNA polymerase III subunit beta [Pseudomonas syringae pv.
           maculicola str. ES4326]
 gi|330987020|gb|EGH85123.1| DNA polymerase III subunit beta [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 367

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 127/389 (32%), Positives = 217/389 (55%), Gaps = 26/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAI--- 57
           M  T++R  +L+ L     ++ER+ T+PV  +VLL      L +  +  E+E+ G +   
Sbjct: 1   MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLTGTDLEVELVGRVQLE 60

Query: 58  -PASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPES 116
            PA     G ITV A  L DI + L + A I    ++   +++ +  G S F L + P +
Sbjct: 61  EPAE---PGEITVPARKLMDICKSLSNDALIDIKLDD---SKLIVKAGRSRFTLSTLPAN 114

Query: 117 EFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVAT 176
           +FP+ +E     +F L  S L+ L+ERT FAMA +++RYYLNG+   ++   L+  AVAT
Sbjct: 115 DFPTVEEGPGSLTFNLVQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVSAGILR--AVAT 172

Query: 177 DGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLS 236
           DGHRLA+  +    + A    +IVPRK + E+ R+L+ +D  V + L +  I       +
Sbjct: 173 DGHRLAMCSMSADIEHADRHQVIVPRKGILEMARLLTEQDGMVSIVLGQHHIRATTGEFT 232

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
            + +L+DG+FP+Y+ V+P   DK +  +   LR+A  R +I+S+ + + ++L L+S +L 
Sbjct: 233 FTSKLVDGKFPDYERVLPKGGDKLVLGDRQALREAFSRTAILSNEKYRGIRLQLASGQLK 292

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           +  +NP+  +A E ++V YN   ++I FN  YLL+++  +++     ++V   L  SNSS
Sbjct: 293 IQANNPEQEEAEEEISVEYNGDSLEIGFNVSYLLDVLGVMTT-----EQVRLILSDSNSS 347

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             ++  D D         ++ YV+MPMR+
Sbjct: 348 ALVQESDND---------DSAYVVMPMRL 367


>gi|126172259|ref|YP_001048408.1| DNA polymerase III subunit beta [Shewanella baltica OS155]
 gi|152998557|ref|YP_001364238.1| DNA polymerase III subunit beta [Shewanella baltica OS185]
 gi|160873128|ref|YP_001552444.1| DNA polymerase III subunit beta [Shewanella baltica OS195]
 gi|217971218|ref|YP_002355969.1| DNA polymerase III subunit beta [Shewanella baltica OS223]
 gi|304412706|ref|ZP_07394309.1| DNA polymerase III, beta subunit [Shewanella baltica OS183]
 gi|307305829|ref|ZP_07585575.1| DNA polymerase III, beta subunit [Shewanella baltica BA175]
 gi|125995464|gb|ABN59539.1| DNA polymerase III, beta subunit [Shewanella baltica OS155]
 gi|151363175|gb|ABS06175.1| DNA polymerase III, beta subunit [Shewanella baltica OS185]
 gi|160858650|gb|ABX47184.1| DNA polymerase III, beta subunit [Shewanella baltica OS195]
 gi|217496353|gb|ACK44546.1| DNA polymerase III, beta subunit [Shewanella baltica OS223]
 gi|304348916|gb|EFM13331.1| DNA polymerase III, beta subunit [Shewanella baltica OS183]
 gi|306911322|gb|EFN41748.1| DNA polymerase III, beta subunit [Shewanella baltica BA175]
 gi|315265353|gb|ADT92206.1| DNA polymerase III, beta subunit [Shewanella baltica OS678]
          Length = 366

 Score =  213 bits (543), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 122/386 (31%), Positives = 221/386 (57%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK +++R  +L+ L   C  +ER++ +P+  ++L++ +   L++  +  E+E+ G +   
Sbjct: 1   MKFSIDRDALLKPLQLVCGAVERRHNLPILSNLLVEVSGHSLKLTGTDLEVELVGQVVVH 60

Query: 61  VDVC-GSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D+  G  TV A  L DIV+ L + +++   +++    +  +  G S F L + P  E+P
Sbjct: 61  GDIEEGRTTVPAKKLLDIVKSLPEQSELKVEQQD---NKWLLRSGRSRFSLATLPAEEYP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + +  +    F L   VLK++++ T F+MA +++RYYLNG+ F    E   L A+ATDGH
Sbjct: 118 NVEAFQAEIEFSLKQGVLKSIIDSTQFSMANQDVRYYLNGLLFET--EGNVLRAIATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA++   I AQ+ +   +IVPRK V E+ R+L S D  + +++ ++ I     +   + 
Sbjct: 176 RLALSHRTIEAQLPE-KQVIVPRKGVMEMARLLESDDLDIAIAIGDNAIRATTANTVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P   DK +  +  +L+QA+ R SI+S+ + + V++ L +  L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKGGDKIVIASRNHLKQALTRASILSNEKFRGVRIQLENGLLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V YN   ++I FN  YLL++++N+ S     D+V   L   NSS  I
Sbjct: 295 NNPEQEEAEEIIDVEYNNQALEIGFNVSYLLDVLNNLKS-----DDVRITLIDGNSSALI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
               ++         ++ YV+MPMR+
Sbjct: 350 ENHLEE---------DSMYVVMPMRL 366


>gi|226942172|ref|YP_002797245.1| DNA polymerase III subunit beta [Azotobacter vinelandii DJ]
 gi|226717099|gb|ACO76270.1| DNA polymerase III, beta chain 1, 2, and 3 protein [Azotobacter
           vinelandii DJ]
          Length = 367

 Score =  213 bits (543), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 128/386 (33%), Positives = 214/386 (55%), Gaps = 20/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M  T++R  +L+ L     ++ER+ T+PV  +VLL      L +  +  E+E+ G +P  
Sbjct: 1   MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEKQQLSLTGTDLEVELVGRVPLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   G ITV A  L DI + L +   I    + +   ++ I  G S F L + P S+FP
Sbjct: 61  ENAEPGEITVPARKLMDICKSLPNDTLIDIRLDEQ---KLLIKAGRSRFSLSTLPASDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + +E     +F L  S L+ L+ERT FAMA +++RYYLNG+   +N   L+  AVATDGH
Sbjct: 118 TAEEGLGSLTFSLGQSKLRRLIERTSFAMAQQDVRYYLNGMLLEMNGGVLR--AVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA+  +    + A    +IVPRK + E+ R+L+ +D  V + L +  I       + + 
Sbjct: 176 RLALCSMQSGIEHADRHQVIVPRKGILELARLLTDQDGEVSIVLGQYHIRATTGEFTFTS 235

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG+FP+Y+ V+P   DK++  +   LR+A  R +I+S+ + + ++L L+S  L +  
Sbjct: 236 KLVDGKFPDYERVLPRGGDKKVLGDRQLLREAFSRTAILSNEKYRGIRLQLASGLLKIQA 295

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E + V Y+   ++I FN  YLL+++  +S+     ++V   L  SNSS  +
Sbjct: 296 NNPEQEEAEEEVAVDYSGDALEIGFNVSYLLDVLGVMSA-----EQVCLTLSDSNSSALL 350

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +  D D         ++ YV+MPMR+
Sbjct: 351 QEADND---------DSAYVVMPMRL 367


>gi|237801663|ref|ZP_04590124.1| DNA polymerase III subunit beta [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331024522|gb|EGI04578.1| DNA polymerase III subunit beta [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 367

 Score =  213 bits (543), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 126/389 (32%), Positives = 218/389 (56%), Gaps = 26/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAI--- 57
           M  T++R  +L+ L     ++ER+ T+PV  +VLL      L +  +  E+E+ G +   
Sbjct: 1   MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVQGQQLSLTGTDLEVELVGRVQLE 60

Query: 58  -PASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPES 116
            PA     G ITV A  L DI + L + A I    ++   +++ +  G S F L + P +
Sbjct: 61  EPAE---PGEITVPARKLMDICKSLSNDALIDIKLDD---SKLIVKAGRSRFTLSTLPAN 114

Query: 117 EFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVAT 176
           +FP+ +E     +F L  S L+ L+ERT FAMA +++RYYLNG+   ++   L+  AVAT
Sbjct: 115 DFPTVEEGPGSLTFNLVQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVSAGILR--AVAT 172

Query: 177 DGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLS 236
           DGHRLA+  +    + A    +IVPRK + E+ R+L+ +D +V + L +  I       +
Sbjct: 173 DGHRLAMCSMSADIEHADRHQVIVPRKGILEMARLLTEQDGTVSIVLGQHHIRATTGEFT 232

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
            + +L+DG+FP+Y+ V+P   DK +  +   LR+A  R +I+S+ + + ++L L+S +L 
Sbjct: 233 FTSKLVDGKFPDYERVLPKGGDKLVMGDRQALREAFSRTAILSNEKYRGIRLQLASGQLK 292

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           +  +NP+  +A E ++V Y+   ++I FN  YLL+++  +++     ++V   L  SNSS
Sbjct: 293 IQANNPEQEEAEEEISVEYSGDSLEIGFNVSYLLDVLGVMTT-----EQVRLILSDSNSS 347

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             ++  D D         ++ YV+MPMR+
Sbjct: 348 ALVQESDND---------DSAYVVMPMRL 367


>gi|197334198|ref|YP_002154782.1| DNA polymerase III, beta subunit [Vibrio fischeri MJ11]
 gi|197315688|gb|ACH65135.1| DNA polymerase III, beta subunit [Vibrio fischeri MJ11]
          Length = 366

 Score =  213 bits (543), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 118/386 (30%), Positives = 221/386 (57%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK ++ERS +L+ L      +  + ++P+  ++LLQ  +G L + A+  E+E+   I   
Sbjct: 1   MKFSIERSLLLKPLQQVSGALGGRPSLPILGNILLQVENGQLSMTATDLEVELISKITLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D   G++TV +    DI R L D A I+   E   G  V +  G S F L + P ++FP
Sbjct: 61  GDFEAGAVTVPSRKFLDICRGLPDSANITIVLE---GDRVLVRSGRSRFTLATLPANDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + +  E      L+ + L+ L+E T F+MA +++RYYLNG+ F       +  +VATDGH
Sbjct: 118 NIEGWESEVEITLSQAQLRKLIESTQFSMANQDVRYYLNGMMFETQGNIFR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AV  + + +++ +   +I+PRK + E++R+L S D SV +    S +   + +   + 
Sbjct: 176 RMAVCNMPVESELPEQ-QVIMPRKGIQELVRLLDSPDQSVTLQFGNSNVRAEVNNFVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P S++K L  +C  LRQA  R +I+S+ + + V+++L+++++ +T 
Sbjct: 235 KLVDGRFPDYRRVMPQSSNKTLEADCDELRQAFARAAILSNEKFRGVRVNLANNQMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V +    ++I FN  Y+L++++ +       + V   + ++N+S  +
Sbjct: 295 NNPEQEEAEEILDVDFQGDDIEIGFNVSYVLDVLNTLKC-----ERVRISMTTANASALV 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
               +D  N++     A YV+MP+R+
Sbjct: 350 ----EDCANDE-----AQYVVMPIRL 366


>gi|114561190|ref|YP_748703.1| DNA polymerase III, beta subunit [Shewanella frigidimarina NCIMB
           400]
 gi|114332483|gb|ABI69865.1| DNA polymerase III, beta subunit [Shewanella frigidimarina NCIMB
           400]
          Length = 366

 Score =  213 bits (542), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 121/387 (31%), Positives = 227/387 (58%), Gaps = 23/387 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITG--AIP 58
           MK +++R  +L+ L   C  +ER++ +P+  ++L++ ++  L++  +  E+E+ G  AI 
Sbjct: 1   MKFSIDRDALLKPLQLVCGAVERRHNLPILANLLVEVSESSLKLTGTDLEVELVGQAAIH 60

Query: 59  ASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEF 118
             +D+ G  TV A  L DIV+ L + +++   +++    +  +  G S F L + P  ++
Sbjct: 61  GDIDI-GRTTVPAKKLLDIVKSLPEQSELKVEQQD---NKWLLRSGRSRFSLATLPAEDY 116

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P+ +E +    F L   VLK++++ T F+MA +++RYYLNG+ F    E   L A+ATDG
Sbjct: 117 PNVEEFQADIEFSLKQGVLKSIIDSTQFSMANQDVRYYLNGLLFET--EGNVLRAIATDG 174

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA++   +   + +   +IVPRK V E+ R+L S D  + +++ ++ I     S   +
Sbjct: 175 HRLALSHRTLDVSLPE-KQVIVPRKGVVEMARLLDSDDQDITIAIGDNAIRAITSSAVFT 233

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +L+DG FP+Y+ V+P   +K +  +   L+QA+ R SI+S+ + + V++ L +  L +T
Sbjct: 234 SKLVDGRFPDYRRVLPKGGNKVVIASRNQLKQALTRASILSNEKFRGVRIQLETGLLKIT 293

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
            +NP+  +A E ++V Y+   ++I FN  YLL++++N++SDEV     +  +D ++S++ 
Sbjct: 294 ANNPEQEEAEEIIDVEYDSDNLEIGFNVSYLLDVLNNLASDEV----RITLIDGNSSALI 349

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
              K++DS           YV+MPMR+
Sbjct: 350 ENHKEEDS----------MYVVMPMRL 366


>gi|88813025|ref|ZP_01128267.1| DNA polymerase III subunit beta [Nitrococcus mobilis Nb-231]
 gi|88789658|gb|EAR20783.1| DNA polymerase III subunit beta [Nitrococcus mobilis Nb-231]
          Length = 366

 Score =  213 bits (542), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 130/385 (33%), Positives = 206/385 (53%), Gaps = 19/385 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+  VER+ +L+ L     ++ER+ T+P+  ++LL A +  L I A+  E+EI     A 
Sbjct: 1   MEFDVERTALLKALQSIIGVVERRQTLPILANILLDAREQRLAITATDLEVEIQAHAQAE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           +   G  T+ A  L DIVR L + A I     ++    + +    S F L + P  +FP+
Sbjct: 61  LSQAGETTLPARKLMDIVRNLPEHADIHVSTSHD---RIALQLPHSRFTLATLPTKDFPT 117

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
            +E       EL  S L+ L++RT FAMA +++RYYLNG+   +  E   L AVATDGHR
Sbjct: 118 VEEIGQTQDLELTQSHLRWLIDRTGFAMALQDVRYYLNGLLLEL--EPYCLRAVATDGHR 175

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LA+AEV     + +   +IVPRK + E+LR+L+  D  +++ L ++ I +    +  + +
Sbjct: 176 LALAEVVTELPLTETKQVIVPRKGIQELLRLLTDSDEPLRLELGDNHIRVTWPEVRFTTK 235

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           L+DG+FP+YQ VIP  N   L+V    LRQA+ R +I+S+  +  V+  L    L +  +
Sbjct: 236 LLDGQFPSYQRVIPKQNGGCLQVERHTLRQALIRAAILSNEHLHGVRFILGGTSLRICSN 295

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           NP   +A E +   Y+    +I FN  YLL+ +  I    V     +F L ++NSS  +R
Sbjct: 296 NPAQEEAEEELTAAYDGEAFEIGFNASYLLDALAAIEESTV----EIF-LTNANSSALLR 350

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
           G   +            YV+MP+R+
Sbjct: 351 GAGNE---------RCRYVVMPLRL 366


>gi|269103821|ref|ZP_06156518.1| DNA polymerase III beta subunit [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163719|gb|EEZ42215.1| DNA polymerase III beta subunit [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 365

 Score =  213 bits (542), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 122/387 (31%), Positives = 220/387 (56%), Gaps = 24/387 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ R  +L+ L      + R  ++P+  ++LLQ  +GLL +  +  E+E+   I   
Sbjct: 1   MKFTLAREQLLKPLQQVSGALGRP-SLPILGNILLQVEEGLLSLTGTDLEVELVAKIVLE 59

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   G+ITV +    DI R L D A IS   E   G    I  G S + L + P S+FP
Sbjct: 60  GEFEAGAITVPSRKFLDICRGLPDSATISVSVE---GDRALIRSGRSRYSLATLPASDFP 116

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    FEL  S L+ L++ T F+MA +++RYYLNG+ F  + + L+   VATDGH
Sbjct: 117 NIDDWQSEVEFELEQSRLRQLIDSTQFSMAHQDVRYYLNGMLFETDGKLLR--TVATDGH 174

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AV  +D    +     II+PRK V E++R+L + ++ V++ +  S +   + +   + 
Sbjct: 175 RMAVCAIDTAYDVPSK-QIILPRKGVLELVRLLDNPEAPVQIQIGGSNLRATVNNFVFTS 233

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P +++K +  +C  LR+A  R +I+S+ + + V+++L++ ++ +T 
Sbjct: 234 KLVDGRFPDYRRVLPQNSNKFVTASCDELRKAFSRAAILSNEKFRGVRVNLAAGEMRITA 293

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y   P++I FN  Y+L++++ +       ++V   L  +N+S  +
Sbjct: 294 NNPEQEEAEEFLDVDYQGEPIEIGFNVSYVLDVLNTLKC-----EQVKMSLTDANASALL 348

Query: 360 RGKDKDSKNNKDNKV-NAFYVLMPMRI 385
                     +DN V +A YV+MP+R+
Sbjct: 349 ----------EDNAVDDAMYVVMPIRL 365


>gi|330890248|gb|EGH22909.1| DNA polymerase III subunit beta [Pseudomonas syringae pv. mori str.
           301020]
          Length = 367

 Score =  213 bits (542), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 127/389 (32%), Positives = 216/389 (55%), Gaps = 26/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAI--- 57
           M  T++R  +L+ L     ++ER+ T+PV  +VLL      L +  +  E+E+ G +   
Sbjct: 1   MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLTGTDLEVELVGRVQLE 60

Query: 58  -PASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPES 116
            PA     G ITV A  L DI + L   A I    ++   +++ +  G S F L + P +
Sbjct: 61  EPAE---PGEITVPARKLMDICKSLSSDALIDIKLDD---SKLIVKAGRSRFTLSTLPAN 114

Query: 117 EFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVAT 176
           +FP+ +E     +F L  S L+ L+ERT FAMA +++RYYLNG+   ++   L+  AVAT
Sbjct: 115 DFPTVEEGPGSLTFNLVQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVSAGILR--AVAT 172

Query: 177 DGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLS 236
           DGHRLA+  +    + A    +IVPRK + E+ R+L+ +D  V + L +  I       +
Sbjct: 173 DGHRLAMCSMSADIEHADRHQVIVPRKGILEMARLLTEQDGMVSIVLGQHHIRATTGEFT 232

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
            + +L+DG+FP+Y+ V+P   DK +  +   LR+A  R +I+S+ + + ++L L+S +L 
Sbjct: 233 FTSKLVDGKFPDYERVLPKGGDKLVLGDRQALREAFSRTAILSNEKYRGIRLQLASGQLK 292

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           +  +NP+  +A E ++V YN   ++I FN  YLL+++  +++     ++V   L  SNSS
Sbjct: 293 IQANNPEQEEAEEEISVEYNGDSLEIGFNVSYLLDVLGVMTT-----EQVRLILSDSNSS 347

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             ++  D D         ++ YV+MPMR+
Sbjct: 348 ALVQESDND---------DSAYVVMPMRL 367


>gi|149912067|ref|ZP_01900658.1| DNA polymerase III subunit beta [Moritella sp. PE36]
 gi|149804863|gb|EDM64900.1| DNA polymerase III subunit beta [Moritella sp. PE36]
          Length = 366

 Score =  213 bits (541), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 126/386 (32%), Positives = 210/386 (54%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ T+ R  +L  L      +  + T+P+  +VLL A +G L +  +  E+E+ G +   
Sbjct: 1   MQFTINREALLRPLQLVSGALGNRPTLPILGNVLLDAKEGKLTLTGTDLEVELIGQVTLE 60

Query: 61  VDVC-GSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   G  TV A  L DI R L D AQI     N+    + +  G S F L + P +EFP
Sbjct: 61  GEFTEGRTTVPAKKLLDICRGLPDSAQIQVSYAND---RIVVKSGRSRFSLSTLPATEFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +    FEL    L+ L++ T F+MA++++RYYLNG+ F      L+   VATDGH
Sbjct: 118 NIEDWDNDIEFELLQGSLRRLIDNTQFSMASQDVRYYLNGMLFETEGNILR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAVA  +  A + K   +IVPRK V E++R+L S++  VK+ L  + I         + 
Sbjct: 176 RLAVASCEHDANL-KQQQVIVPRKGVLELVRLLDSEEDMVKIQLGSNNIRAITSGFVFTC 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK L  +   L+QA  R +I+S+ + + V+L+++   L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKNADKMLISSREELKQAFSRAAILSNEKFRGVRLNMNQGLLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V +    ++I FN  Y+L++++ +       +++   L  +NSS  I
Sbjct: 295 NNPEQEEAEELLDVAFAHDELEISFNVSYVLDVLNTLKC-----EKIKISLSDANSSALI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +  D          A YV+MPMR+
Sbjct: 350 EDEQSD---------QALYVVMPMRL 366


>gi|254282661|ref|ZP_04957629.1| DNA polymerase III, beta subunit [gamma proteobacterium NOR51-B]
 gi|219678864|gb|EED35213.1| DNA polymerase III, beta subunit [gamma proteobacterium NOR51-B]
          Length = 365

 Score =  213 bits (541), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 128/388 (32%), Positives = 215/388 (55%), Gaps = 26/388 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           M  T+ R  +++ L     ++ER+ T+P+  +VLL+     LE+  +  E+E+ G +  A
Sbjct: 1   MNFTIPRDALIKPLNLVAGVVERRQTLPILSNVLLRVEGNRLELTGTDLEVELLGRVDLA 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G ITV A  L DI + L +G++I+F  ++   T   +  G S F L + P ++FP
Sbjct: 61  EPGEAGEITVPARKLVDICKSLPEGSEINFSVDSGKAT---VKAGRSRFTLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + +  E   S  L  SVLK L++RT FAMA +++RYYLNG+   I    L++  VATDGH
Sbjct: 118 TVESSEGEVSVSLPQSVLKRLIDRTGFAMAQQDVRYYLNGMLLEILGGRLRM--VATDGH 175

Query: 180 RLAV--AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           RLA+  A+  + A  A   S+I+PRK V E+ R+L   D  V + +  + +       + 
Sbjct: 176 RLALCTAQEPVEAGDA---SVIIPRKGVLELARLLEG-DGPVTLVIGSNHVRAANLQFTF 231

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +L+DG+FP Y+ V+P S DK +  +   LRQA  R +I+S+ + + V+L ++ D L +
Sbjct: 232 TSKLVDGKFPEYERVLPKSPDKSVVGDRQTLRQAFTRTAILSNEKYRGVRLKIADDTLEI 291

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           T +NP+  +A E ++V +   P+++ FN  YLL+++  +      D++V   L  + SS 
Sbjct: 292 TANNPEQEQAEEVVSVEFQGDPLEVGFNVSYLLDVLSVLG-----DEKVRLSLADAASSA 346

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            +   D           ++ YV+MPMR+
Sbjct: 347 LLEEADGG---------DSLYVVMPMRL 365


>gi|28867245|ref|NP_789864.1| DNA polymerase III subunit beta [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213968440|ref|ZP_03396583.1| DNA polymerase III, beta subunit [Pseudomonas syringae pv. tomato
           T1]
 gi|301384272|ref|ZP_07232690.1| DNA polymerase III subunit beta [Pseudomonas syringae pv. tomato
           Max13]
 gi|302063878|ref|ZP_07255419.1| DNA polymerase III subunit beta [Pseudomonas syringae pv. tomato
           K40]
 gi|302131961|ref|ZP_07257951.1| DNA polymerase III subunit beta [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|28850479|gb|AAO53559.1| DNA polymerase III, beta subunit [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213926728|gb|EEB60280.1| DNA polymerase III, beta subunit [Pseudomonas syringae pv. tomato
           T1]
 gi|331017724|gb|EGH97780.1| DNA polymerase III subunit beta [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 367

 Score =  213 bits (541), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 126/389 (32%), Positives = 217/389 (55%), Gaps = 26/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAI--- 57
           M  T++R  +L+ L     ++ER+ T+PV  +VLL      L +  +  E+E+ G +   
Sbjct: 1   MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVQGQQLSLTGTDLEVELVGRVQLE 60

Query: 58  -PASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPES 116
            PA     G ITV A  L DI + L + A I    ++   +++ +  G S F L + P +
Sbjct: 61  EPAE---PGEITVPARKLMDICKSLPNDALIDIKLDD---SKLIVKAGRSRFTLSTLPAN 114

Query: 117 EFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVAT 176
           +FP+ +E     +F L  S L+ L+ERT FAMA +++RYYLNG+   ++   L+  AVAT
Sbjct: 115 DFPTVEEGPGSLTFNLVQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVSAGILR--AVAT 172

Query: 177 DGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLS 236
           DGHRLA+  +    + A    +IVPRK + E+ R+L+ +D  V + L +  I       +
Sbjct: 173 DGHRLAMCSMSADIEHADRHQVIVPRKGILEMARLLTEQDGMVSIVLGQHHIRATTGEFT 232

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
            + +L+DG+FP+Y+ V+P   DK +  +  +LR+A  R +I+S+ + + ++L L++ +L 
Sbjct: 233 FTSKLVDGKFPDYERVLPKGGDKLVLGDRQSLREAFSRTAILSNEKYRGIRLQLANGQLK 292

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           +  +NP+  +A E + V YN   ++I FN  YLL+++  +++     ++V   L  SNSS
Sbjct: 293 IQANNPEQEEAEEEIGVEYNGEALEIGFNVSYLLDVLSVMTT-----EQVRLILSDSNSS 347

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             ++  D D         ++ YV+MPMR+
Sbjct: 348 ALVQESDND---------DSAYVVMPMRL 367


>gi|330876356|gb|EGH10505.1| DNA polymerase III subunit beta [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330964180|gb|EGH64440.1| DNA polymerase III subunit beta [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 367

 Score =  212 bits (540), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 126/389 (32%), Positives = 216/389 (55%), Gaps = 26/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAI--- 57
           M  T++R  +L+ L     ++ER+ T+PV  +VLL      L +  +  E+E+ G +   
Sbjct: 1   MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVQGQQLSLTGTDLEVELVGRVQLE 60

Query: 58  -PASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPES 116
            PA     G ITV A  L DI + L + A I    ++   +++ +  G S F L + P +
Sbjct: 61  EPAE---PGEITVPARKLMDICKSLSNDALIDIKLDD---SKLIVKAGRSRFTLSTLPAN 114

Query: 117 EFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVAT 176
           +FP+ +E     +F L  S L+ L+ERT FAMA +++RYYLNG+   ++   L+  AVAT
Sbjct: 115 DFPTVEEGPGSLTFNLVQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVSAGILR--AVAT 172

Query: 177 DGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLS 236
           DGHRLA+  +    + A    +IVPRK + E+ R+L+ +D  V + L +  I       +
Sbjct: 173 DGHRLAMCSMSADIEHADRHQVIVPRKGILEMARLLTEQDGMVSIVLGQHHIRATTGEFT 232

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
            + +L+DG+FP+Y+ V+P   DK +  +   LR+A  R +I+S+ + + ++L L++ +L 
Sbjct: 233 FTSKLVDGKFPDYERVLPKGGDKLVLGDRQALREAFSRTAILSNEKYRGIRLQLANGQLK 292

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           +  +NP+  +A E + V YN   ++I FN  YLL+++  +++     ++V   L  SNSS
Sbjct: 293 IQANNPEQEEAEEEIGVEYNGESLEIGFNVSYLLDVLSVMTT-----EQVRLILSDSNSS 347

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             ++  D D         ++ YV+MPMR+
Sbjct: 348 ALVQESDND---------DSAYVVMPMRL 367


>gi|312882234|ref|ZP_07741980.1| DNA polymerase III subunit beta [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309370078|gb|EFP97584.1| DNA polymerase III subunit beta [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 366

 Score =  212 bits (540), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 121/386 (31%), Positives = 223/386 (57%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK +++RS +L+ L      +  + T+P+  ++LL+  DG+L I A+  E+E+   +   
Sbjct: 1   MKFSIQRSHLLKPLQQVSGALGGRPTLPILGNLLLKVADGMLLITATDLEVELISRVNLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   G+ITV +    DI R L D A I+F  E   G  V I  G S F L + P  +FP
Sbjct: 61  GEFEAGTITVPSRKFLDICRGLPDEAVITFVLE---GDRVQIRSGRSRFSLSTLPAHDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +      L  + L+ LVE+T F+MA +++RYYLNG+ F +  +   L +VATDGH
Sbjct: 118 NIEDWQSEVEVSLTQAELRTLVEKTQFSMANQDVRYYLNGMLFEL--DGTTLSSVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+A+A+V++  + A+   IIVPRK V E++++L + +  V + +  S +   + +   + 
Sbjct: 176 RMAMAQVNLEGEFAQQ-QIIVPRKGVLELVKLLDAPEQKVVLQVGSSNVRAEVNNYVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+  +  K L  +C  L+ A  R +I+S+ + + V+++L+  ++ +T 
Sbjct: 235 KLVDGRFPDYRRVMSLTPSKTLLADCDQLKHAFSRAAILSNEKFRGVRVNLTDSEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    ++I FN  Y+L++++ +  +EV     V   D+++S++  
Sbjct: 295 NNPEQEEAEEILDVNYQGEAIEIGFNVGYVLDVLNTLKCNEV----RVSMTDATSSTLI- 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
                  +N +DN  +A YV+ P+R+
Sbjct: 350 -------ENAQDN--SAVYVVSPIRL 366


>gi|114045515|ref|YP_736065.1| DNA polymerase III subunit beta [Shewanella sp. MR-7]
 gi|113886957|gb|ABI41008.1| DNA polymerase III, beta subunit [Shewanella sp. MR-7]
          Length = 366

 Score =  212 bits (540), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 120/386 (31%), Positives = 222/386 (57%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK +++R  +L+ L   C  +ER++ +P+  ++L++ +   L++  +  E+E+ G     
Sbjct: 1   MKFSIDRDALLKPLQLVCGAVERRHNLPILANLLVEVSGHSLKMTGTDLEVELVGQAVVH 60

Query: 61  VDVC-GSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D+  G  TV A  L DIV+ L + +++   +++    +  +  G S F L + P  E+P
Sbjct: 61  GDIEEGRTTVPAKKLLDIVKSLPEQSELKVEQQD---NKWLLRSGRSRFSLATLPAEEYP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + +  +    F L   VLK+L++ T F+MA +++RYYLNG+      E   L A+ATDGH
Sbjct: 118 NVEAFQAEIEFTLKQGVLKSLIDATQFSMANQDVRYYLNGLLLET--EGNVLRAIATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA++   I AQ+ +   +IVPRK V E+ R+L + D  + +++ ++ I     +   + 
Sbjct: 176 RLALSHRTIDAQLPE-KQVIVPRKGVMEMARLLEADDLDIAIAIGDNAIRATTSTTVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P   DK +  +  + +QA+ R SI+S+ + + V++ L +  L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKGGDKIVIASRNHFKQALTRASILSNEKFRGVRIQLEAGLLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V YN  P++I FN  YLL++++N+ SD+V     +  +D ++S++  
Sbjct: 295 NNPEQEEAEEIIDVDYNNQPLEIGFNVSYLLDVLNNLKSDDV----RITLIDGNSSALLE 350

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              ++DS           YV+MPMR+
Sbjct: 351 NHLEEDS----------MYVVMPMRL 366


>gi|304414286|ref|ZP_07395654.1| DNA polymerase III beta subunit [Candidatus Regiella insecticola
           LSR1]
 gi|304283500|gb|EFL91896.1| DNA polymerase III beta subunit [Candidatus Regiella insecticola
           LSR1]
          Length = 375

 Score =  212 bits (540), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 132/394 (33%), Positives = 217/394 (55%), Gaps = 28/394 (7%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T++R  +L+ L      +  +  +P+  ++LLQ +D  L +  +  EIE+   I  S
Sbjct: 1   MKFTIKREHLLKPLQQVSGPLSARTALPILANLLLQVSDNTLTLTGTDLEIEMVATIALS 60

Query: 61  VD---VCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESE 117
                  GS TV A   +DI R L + A+I+   E +    ++I  G S F L      +
Sbjct: 61  QSHKTETGSTTVPARKFFDICRGLPEDAEITVTLETK---RLSIRSGHSRFSLSILSARD 117

Query: 118 FPSTKE--EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVA 175
           FP+  +  +E      ++ + LK L++ T FAMA +++RYYLNG+ F +  E  KLCA+ 
Sbjct: 118 FPNLADLKKEKEVELTVSPAALKCLIDSTQFAMAHQDVRYYLNGMLFEVEGE--KLCAIT 175

Query: 176 TDGHRLAVAEVDIV----AQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLN 231
           TDGHRLAV    I+    AQ  K  S+IVPRKAV E+ R+LS  +  + + +  + I ++
Sbjct: 176 TDGHRLAVCSTSIIQKDTAQELKKYSVIVPRKAVIELARLLSGGEDRLCLQIGSNNIRVH 235

Query: 232 IESLSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLS 291
           +     + +L+DG FP+Y+ V P +  K +  NC  L+QA  R +I+S+ + + V+L +S
Sbjct: 236 LNGFIFTSKLVDGRFPDYKRVFPKNPSKIVIANCEQLKQAFSRAAILSNAKFRGVRLHIS 295

Query: 292 SDKLCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLD 351
           + KL +T +NP+  +A E+++V Y    ++I FN  YLL++++ +       D+V   L 
Sbjct: 296 AGKLKITANNPEQEEAEETLDVDYQGEDIEISFNVGYLLDVLNALKC-----DKVKLLLI 350

Query: 352 SSNSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            S SSV I         N +N++   Y++MPMR+
Sbjct: 351 DSVSSVQI--------ENIENQITT-YIVMPMRL 375


>gi|330500916|ref|YP_004377785.1| DNA polymerase III subunit beta [Pseudomonas mendocina NK-01]
 gi|328915202|gb|AEB56033.1| DNA polymerase III subunit beta [Pseudomonas mendocina NK-01]
          Length = 367

 Score =  212 bits (539), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 125/387 (32%), Positives = 213/387 (55%), Gaps = 22/387 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M  T++R  +L+ L     ++ER+ T+PV  +VLL      L +  +  E+E+ G +   
Sbjct: 1   MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLTGTDLEVELVGRVTLE 60

Query: 61  VDVC--GSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEF 118
            D    G ITV A  L DI + L   A I    +++   ++ +  G S F L + P ++F
Sbjct: 61  -DAAEPGEITVPARKLMDICKSLPSDALIDIRVDDQ---KLLVKAGRSRFTLSTLPANDF 116

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P+ +E     +F L  + L+ L+ERT FAMA +++RYYLNG+   +    L+  AVATDG
Sbjct: 117 PTVEEGPGSLTFNLPQAKLRRLIERTSFAMAQQDVRYYLNGMLLEVQSGLLR--AVATDG 174

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA+  ++   Q      +IVPRK + E+ R+L+ +D+ V + L +  I  N    + +
Sbjct: 175 HRLAMCSMEASIQQDGKHQVIVPRKGILELARLLTEQDAEVSIVLGQHHIRANTGEFTFT 234

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +L+DG+FP+Y+ V+P   DK +  +   LR+A  R +I+S+ + + ++L+L+   L + 
Sbjct: 235 SKLVDGKFPDYERVLPRGGDKLVLADRQGLREAFSRTAILSNEKYRGIRLTLADGLLKIQ 294

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
            +NP+  +A E + V YN   ++I FN  YLL+++  + +     ++V   L  SNSS  
Sbjct: 295 ANNPEQEEAEEEIVVDYNGGGLEIGFNVSYLLDVLGVMGT-----EQVRLILSDSNSSAL 349

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           ++  D D         ++ YV+MPMR+
Sbjct: 350 LQEADND---------DSAYVVMPMRL 367


>gi|257485598|ref|ZP_05639639.1| DNA polymerase III subunit beta [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|289628213|ref|ZP_06461167.1| DNA polymerase III subunit beta [Pseudomonas syringae pv. aesculi
           str. NCPPB3681]
 gi|289649103|ref|ZP_06480446.1| DNA polymerase III subunit beta [Pseudomonas syringae pv. aesculi
           str. 2250]
 gi|330870076|gb|EGH04785.1| DNA polymerase III subunit beta [Pseudomonas syringae pv. aesculi
           str. 0893_23]
 gi|331011886|gb|EGH91942.1| DNA polymerase III subunit beta [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 367

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 126/389 (32%), Positives = 217/389 (55%), Gaps = 26/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAI--- 57
           M  T++R  +L+ L     ++ER+ T+PV  +VLL      L +  +  E+E+ G +   
Sbjct: 1   MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLTGTDLEVELVGRVQLE 60

Query: 58  -PASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPES 116
            PA     G ITV A  L DI + L + A I    ++   +++ +  G S F L + P +
Sbjct: 61  EPAE---PGEITVPARKLMDICKSLSNDALIDIKLDD---SKLIVKAGRSRFTLSTLPAN 114

Query: 117 EFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVAT 176
           +FP+ +E     +F L  S L+ L+ERT FAMA +++RYYLNG+   ++   L+  AVAT
Sbjct: 115 DFPTVEEGPGSLTFNLVQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVSAGILR--AVAT 172

Query: 177 DGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLS 236
           DGHRLA+  +    + A    +IVPRK + E+ R+L+ +D  V + L +  I       +
Sbjct: 173 DGHRLAMCSMSADIEHADRHQVIVPRKGILEMARLLTEQDGMVSIVLGQHHIRATTGEFT 232

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
            + +L+DG+FP+Y+ V+P   DK +  +   LR+A  R +I+S+ + + ++L L++ +L 
Sbjct: 233 FTSKLVDGKFPDYERVLPKGGDKLVLGDRQALREAFSRTAILSNEKYRGIRLQLANGQLK 292

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           +  +NP+  +A E ++V YN   ++I FN  YLL+++  +++     ++V   L  SNSS
Sbjct: 293 IQANNPEQEEAEEEISVEYNGDSLEIGFNVSYLLDVLGVMTT-----EQVRLILSDSNSS 347

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             ++  D D         ++ YV+MPMR+
Sbjct: 348 ALVQESDND---------DSAYVVMPMRL 367


>gi|15595200|ref|NP_064722.1| DNA polymerase III subunit beta [Pseudomonas aeruginosa PAO1]
 gi|107098996|ref|ZP_01362914.1| hypothetical protein PaerPA_01000002 [Pseudomonas aeruginosa PACS2]
 gi|116053722|ref|YP_788157.1| DNA polymerase III subunit beta [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218888748|ref|YP_002437612.1| DNA polymerase III subunit beta [Pseudomonas aeruginosa LESB58]
 gi|254237755|ref|ZP_04931078.1| DNA polymerase III, beta chain [Pseudomonas aeruginosa C3719]
 gi|254243116|ref|ZP_04936438.1| DNA polymerase III, beta chain [Pseudomonas aeruginosa 2192]
 gi|296386474|ref|ZP_06875973.1| DNA polymerase III subunit beta [Pseudomonas aeruginosa PAb1]
 gi|313111476|ref|ZP_07797277.1| DNA polymerase III, beta chain [Pseudomonas aeruginosa 39016]
 gi|13959347|sp|Q9I7C4|DPO3B_PSEAE RecName: Full=DNA polymerase III subunit beta
 gi|9945820|gb|AAG03392.1|AE004440_2 DNA polymerase III, beta chain [Pseudomonas aeruginosa PAO1]
 gi|115588943|gb|ABJ14958.1| DNA polymerase III, beta chain [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126169686|gb|EAZ55197.1| DNA polymerase III, beta chain [Pseudomonas aeruginosa C3719]
 gi|126196494|gb|EAZ60557.1| DNA polymerase III, beta chain [Pseudomonas aeruginosa 2192]
 gi|218768971|emb|CAW24729.1| DNA polymerase III, beta chain [Pseudomonas aeruginosa LESB58]
 gi|310883779|gb|EFQ42373.1| DNA polymerase III, beta chain [Pseudomonas aeruginosa 39016]
          Length = 367

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 129/391 (32%), Positives = 215/391 (54%), Gaps = 30/391 (7%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITG-AIPA 59
           M  T++R  +L+ L     ++ER+ T+PV  +VLL      L +  +  E+E+ G  +  
Sbjct: 1   MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLTGTDLEVELVGRVVLE 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G ITV A  L DI + L +   I    E +   ++ +  G S F L + P ++FP
Sbjct: 61  DAAEPGEITVPARKLMDICKSLPNDVLIDIRVEEQ---KLLVKAGRSRFTLSTLPANDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + +E     +F +A S L+ L++RT FAMA +++RYYLNG+   +N   L+  +VATDGH
Sbjct: 118 TVEEGPGSLNFSIAQSKLRRLIDRTSFAMAQQDVRYYLNGMLLEVNGGTLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPS-----IIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIES 234
           RLA+  +D     A++PS     +IVPRK + E+ R+L+ +D  V + L +  I      
Sbjct: 176 RLAMCSLD-----AQIPSQDRHQVIVPRKGILELARLLTEQDGEVGIVLGQHHIRATTGE 230

Query: 235 LSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDK 294
            + + +L+DG+FP+Y+ V+P   DK +  +   LR+A  R +I+S+ + + ++L LS+  
Sbjct: 231 FTFTSKLVDGKFPDYERVLPRGGDKLVVGDRQQLREAFSRTAILSNEKYRGIRLQLSNGL 290

Query: 295 LCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSN 354
           L +  +NP+  +A E + V YN   ++I FN  YLL+++  I +     ++V F L  SN
Sbjct: 291 LKIQANNPEQEEAEEEVQVEYNGGNLEIGFNVSYLLDVLGVIGT-----EQVRFILSDSN 345

Query: 355 SSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           SS  +   D D         ++ YV+MPMR+
Sbjct: 346 SSALVHEADND---------DSAYVVMPMRL 367


>gi|113968348|ref|YP_732141.1| DNA polymerase III subunit beta [Shewanella sp. MR-4]
 gi|117918469|ref|YP_867661.1| DNA polymerase III subunit beta [Shewanella sp. ANA-3]
 gi|113883032|gb|ABI37084.1| DNA polymerase III, beta subunit [Shewanella sp. MR-4]
 gi|117610801|gb|ABK46255.1| DNA polymerase III, beta subunit [Shewanella sp. ANA-3]
          Length = 366

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 120/386 (31%), Positives = 222/386 (57%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK +++R  +L+ L   C  +ER++ +P+  ++L++ +   L++  +  E+E+ G     
Sbjct: 1   MKFSIDRDALLKPLQLVCGAVERRHNLPILANLLVEVSGHSLKMTGTDLEVELVGQAVIH 60

Query: 61  VDVC-GSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D+  G  TV A  L DIV+ L + +++   +++    +  +  G S F L + P  E+P
Sbjct: 61  GDIEEGRTTVPAKKLLDIVKSLPEQSELKVEQQD---NKWLLRSGRSRFSLATLPAEEYP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + +  +    F L   VLK+L++ T F+MA +++RYYLNG+      E   L A+ATDGH
Sbjct: 118 NVEAFQAEIEFTLKQGVLKSLIDATQFSMANQDVRYYLNGLLLET--EGNVLRAIATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA++   I AQ+ +   +IVPRK V E+ R+L + D  + +++ ++ I     +   + 
Sbjct: 176 RLALSHRTIDAQLPE-KQVIVPRKGVMEMARLLEADDLDIAIAIGDNAIRATTSTTVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P   DK +  +  + +QA+ R SI+S+ + + V++ L +  L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKGGDKIVIASRNHFKQALTRASILSNEKFRGVRIQLEAGLLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V YN  P++I FN  YLL++++N+ SD+V     +  +D ++S++  
Sbjct: 295 NNPEQEEAEEIIDVDYNNQPLEIGFNVSYLLDVLNNLKSDDV----RITLIDGNSSALLE 350

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              ++DS           YV+MPMR+
Sbjct: 351 NHLEEDS----------MYVVMPMRL 366


>gi|298484610|ref|ZP_07002715.1| DNA polymerase III beta subunit [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298160867|gb|EFI01883.1| DNA polymerase III beta subunit [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 367

 Score =  211 bits (538), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 126/389 (32%), Positives = 217/389 (55%), Gaps = 26/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAI--- 57
           M  T++R  +L+ L     ++ER+ T+PV  +VLL      L +  +  E+E+ G +   
Sbjct: 1   MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLTGTDLEVELVGRVQLE 60

Query: 58  -PASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPES 116
            PA     G ITV A  L DI + L + A I    ++   +++ +  G S F L + P +
Sbjct: 61  EPAE---PGEITVPARKLMDICKSLSNDALIDVKLDD---SKLIVKAGRSRFTLSTLPAN 114

Query: 117 EFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVAT 176
           +FP+ +E     +F L  S L+ L+ERT FAMA +++RYYLNG+   ++   L+  AVAT
Sbjct: 115 DFPTVEEGPGSLTFNLVQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVSAGILR--AVAT 172

Query: 177 DGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLS 236
           DGHRLA+  +    + A    +IVPRK + E+ R+L+ +D  V + L +  I       +
Sbjct: 173 DGHRLAMCSMSADIEHADRHQVIVPRKGILEMARLLTEQDGMVSIVLGQHHIRATTGEFT 232

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
            + +L+DG+FP+Y+ V+P   DK +  +   LR+A  R +I+S+ + + ++L L++ +L 
Sbjct: 233 FTSKLVDGKFPDYERVLPKGGDKLVLGDRQALREAFSRTAILSNEKYRGIRLQLANGQLK 292

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           +  +NP+  +A E ++V YN   ++I FN  YLL+++  +++     ++V   L  SNSS
Sbjct: 293 IQANNPEQEEAEEEISVEYNGDSLEIGFNVSYLLDVLGVMTT-----EQVRLILSDSNSS 347

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             ++  D D         ++ YV+MPMR+
Sbjct: 348 ALVQESDND---------DSAYVVMPMRL 367


>gi|59710617|ref|YP_203393.1| DNA polymerase III subunit beta [Vibrio fischeri ES114]
 gi|59478718|gb|AAW84505.1| DNA polymerase III, beta subunit [Vibrio fischeri ES114]
          Length = 366

 Score =  211 bits (538), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 117/386 (30%), Positives = 221/386 (57%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK ++ERS +L+ L      +  + ++P+  ++LLQ  +G L + A+  E+E+   I   
Sbjct: 1   MKFSIERSLLLKPLQQVSGALGGRPSLPILGNILLQVENGQLSMTATDLEVELISKITLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D   G++TV +    DI R L D A I+   E   G  V +  G S F L + P ++FP
Sbjct: 61  GDFEAGAVTVPSRKFLDICRGLPDSANITIVLE---GDRVLVRSGRSRFTLATLPANDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + +  E      L+ + L+ L+E T F+MA +++RYYLNG+ F       +  +VATDGH
Sbjct: 118 NIEGWESEVEITLSQAQLRKLIESTQFSMANQDVRYYLNGMMFETQGNIFR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AV  + + +++ +   +I+PRK + E++R+L S + SV +    S +   + +   + 
Sbjct: 176 RMAVCNMPVESELPEQ-QVIMPRKGIQELVRLLDSPEQSVTLQFGNSNVRAEVNNFVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P S++K L  +C  LRQA  R +I+S+ + + V+++L+++++ +T 
Sbjct: 235 KLVDGRFPDYRRVMPQSSNKTLEADCDELRQAFARAAILSNEKFRGVRVNLANNQMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V +    ++I FN  Y+L++++ +       + V   + ++N+S  +
Sbjct: 295 NNPEQEEAEEILDVDFQGDDIEIGFNVSYVLDVLNTLKC-----ERVRISMTTANASALV 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
               +D  N++     A YV+MP+R+
Sbjct: 350 ----EDCANDE-----AQYVVMPIRL 366


>gi|239993751|ref|ZP_04714275.1| DNA polymerase III, beta subunit [Alteromonas macleodii ATCC 27126]
 gi|332139412|ref|YP_004425150.1| DNA polymerase III subunit beta [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327549434|gb|AEA96152.1| DNA polymerase III subunit beta [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 366

 Score =  211 bits (537), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 125/388 (32%), Positives = 219/388 (56%), Gaps = 25/388 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ R   L+ L      +ER++T+P+  +VL++ ++  L +  +  E+E+  ++   
Sbjct: 1   MKFTISREQFLQPLQLVSGAVERRHTLPILSNVLIKVSEDALWLTGTDLEVELISSVKLE 60

Query: 61  VDVC-GSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   G ITV A  L+DI+R + +G  I F  +   G++  I  G   + L +   +++P
Sbjct: 61  GEFTEGEITVPAKKLFDIIRGISEGTDIHFSLD---GSKALIRAGRGRYTLSTLSANDYP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ E    FEL+ S LK L++ T F+MA +++RYYLNG+     E  ++   VATDGH
Sbjct: 118 NLEDWEGEVEFELSCSDLKRLIDATSFSMAQQDVRYYLNGMSLETEENIIR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPS--IIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           RLA+  ++       +PS  +I+PRK V EI R++S  D S+KV +  + + +       
Sbjct: 176 RLALCRLNYET---ALPSRQVIIPRKGVLEISRLISEDDKSLKVQIGANHLRIFSNDFIF 232

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +L+DG FP+Y+ V+P + DKE+  +   L++A  R +I+S+ + + V+L+LSS +L +
Sbjct: 233 TSKLVDGRFPDYRRVLPQNGDKEIIASKAVLKEAFSRAAILSNEKFRGVRLNLSSGELKI 292

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           T +NP+  +A E ++V Y    ++I FN  YL+++++ + S     D V   L  SN+S 
Sbjct: 293 TANNPEQEEAEEIVDVQYQGDDLEIGFNVAYLIDVLNALGS-----DGVKVSLSDSNASA 347

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            I     D+         A YV+MPMR+
Sbjct: 348 LIEDDADDA---------ALYVIMPMRL 366


>gi|192362292|ref|YP_001980526.1| DNA polymerase III subunit beta [Cellvibrio japonicus Ueda107]
 gi|190688457|gb|ACE86135.1| DNA polymerase III, beta subunit [Cellvibrio japonicus Ueda107]
          Length = 367

 Score =  211 bits (537), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 127/386 (32%), Positives = 211/386 (54%), Gaps = 20/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK  V R  +L+ L     ++ER+ T+PV  +VL+Q     L +  +  E+EI G +   
Sbjct: 1   MKFAVSREALLKPLQLVAGVVERRQTLPVLSNVLIQLEGDQLSLTGTDLEVEIIGRLTLE 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G ITV A  L DI R L DG+ I FF E      + +  G S F L + P S+FP
Sbjct: 61  QAGQSGEITVPARKLVDICRSLPDGSTIEFFLEE---NRILVKSGRSRFTLSTLPASDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++      F  A + +K L+ERT FAMA +++RYYLNG+ + + ++ L++  VATDGH
Sbjct: 118 NVEDAPGNLRFSCAQAEVKRLIERTAFAMAQQDVRYYLNGMLWEVRQDHLRV--VATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+A+    I      +   I+PRK V E+ R+L    + V+V LS + I +     + + 
Sbjct: 176 RMAMCTRAIAVNTDDVVQAILPRKGVLELSRLLDDSSAQVEVVLSANHIRVTSVDYTFTS 235

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG+FP Y+ V+P   +K +  +   L+QA  R +I+S+ + + V+L LS+  L +  
Sbjct: 236 KLVDGKFPEYERVLPRGGNKVVIGSRLELKQAFARTAILSNEKYRGVRLLLSNGVLTIVA 295

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E + V Y    ++I FN  YL ++ + IS++ +     +  LD+++S++  
Sbjct: 296 NNPEQEEAEEQVTVDYTGESLEIGFNVSYLQDVANVISNENI----KITLLDANSSALLE 351

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             ++ DS           YV+MPMR+
Sbjct: 352 EPENSDS----------LYVVMPMRL 367


>gi|90408443|ref|ZP_01216603.1| Putative DNA polymerase III, beta chain [Psychromonas sp. CNPT3]
 gi|90310427|gb|EAS38552.1| Putative DNA polymerase III, beta chain [Psychromonas sp. CNPT3]
          Length = 368

 Score =  211 bits (537), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 126/387 (32%), Positives = 221/387 (57%), Gaps = 21/387 (5%)

Query: 1   MKITVERSDILELLGH-ACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP- 58
           M+ ++ R   L  L   A  +   +  +P+  ++L+Q  DG+L +  +  E+E+   I  
Sbjct: 1   MQFSISREAFLRPLQLVAGSVAGGRPALPIMANILIQIKDGILSLTGTDLEVELITQIHL 60

Query: 59  ASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEF 118
            S    G ITV A  L +I R L D  +I F  +++    V +  G S + L S P S+F
Sbjct: 61  ESPSEEGEITVPARKLLNICRGLSDPCEIKFQVKDD---RVTVRSGRSRYLLSSLPASDF 117

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P+ +  + +  F +A    K L+E T FAMA++++RYYLNG++F  + + L+  +VATDG
Sbjct: 118 PNIESWKSLAEFNVAQKEFKKLIEFTQFAMASQDVRYYLNGMYFEASGDSLR--SVATDG 175

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA   + +   I +  S+IVPRK V E++++L ++  +V + + ++ +   I +   +
Sbjct: 176 HRLASCAIKLSTPIEEQ-SLIVPRKGVVELVKLLDNEQENVTIQIGKNNLRAIIGNFIFT 234

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +L+DG FP+Y+ VIP + DKEL  +  +L+QA  R +I+S+ + + V+L+LS + L +T
Sbjct: 235 SKLVDGRFPDYRRVIPRNGDKELIASRESLKQAFTRAAILSNEKFRGVRLTLSKNLLQIT 294

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
            +NP+  +A E +++ Y    ++I FN  Y+L++++ + S+++   ++ F   SS  S  
Sbjct: 295 ANNPEREEAEEYIDIDYQASDLEIGFNVSYVLDVLNTLKSEKI---KITF--SSSAHSAL 349

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           I   D D         +A YVLMPMR+
Sbjct: 350 IESIDADD--------DALYVLMPMRL 368


>gi|190571329|ref|YP_001975687.1| DNA polymerase III, beta subunit [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213018725|ref|ZP_03334533.1| DNA polymerase III, beta subunit [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357601|emb|CAQ55042.1| DNA polymerase III, beta subunit [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995676|gb|EEB56316.1| DNA polymerase III, beta subunit [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 383

 Score =  211 bits (537), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 125/384 (32%), Positives = 218/384 (56%), Gaps = 20/384 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ +V R+ +L  L     ++ER+N I V   + ++A  G +++KA+  +I I  ++ A+
Sbjct: 19  MRFSVSRASLLNTLSRVSGVVERRNAIDVLACINIKAQYGSIKLKATDLDISIFASLTAN 78

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V   G + +SAH L+DIV+KL     ++F   N+   ++ IS G++NF L +   + FP 
Sbjct: 79  VSAEGEVKISAHTLHDIVKKLPTNLDVNFEMNNQ--GKLLISCGNANFSLPNVVSNNFPV 136

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
            +E ++ Y F L S+ L +L+ +T FA++ ++ RY LNGI+ H +E+   L  VATDGHR
Sbjct: 137 LEEGDHQYDFTLLSADLVDLLTKTKFAVSLDDTRYNLNGIYLHTDEQ--FLYCVATDGHR 194

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           L+  +      I     +I+PRK + E+L++L   +  + + LS+ +I        +  +
Sbjct: 195 LSCIKRPKPEDINGEFGVIIPRKTIMELLKVLDDCNE-INIKLSDRKIKFTCGEYILISK 253

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDG FP+Y+ VIP S DK++ V  + L   +DRVS++ S +I+++K SL  + L +  +
Sbjct: 254 LIDGTFPDYKAVIPTSQDKQMIVESSKLASVIDRVSVVVSDKIKSIKFSLQENLLTLHSN 313

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           + +   A ES+ V Y+   M++ FN +YLL+++        ++++  F L   NS+  I 
Sbjct: 314 SQECSDATESIEVDYDGALMEVGFNSRYLLDVL------SCIENKCKFSLSDGNSATIIT 367

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMR 384
            +D  S         A Y++MPMR
Sbjct: 368 DEDDPS---------ALYIVMPMR 382


>gi|146305044|ref|YP_001185509.1| DNA polymerase III subunit beta [Pseudomonas mendocina ymp]
 gi|145573245|gb|ABP82777.1| DNA polymerase III, beta subunit [Pseudomonas mendocina ymp]
          Length = 367

 Score =  211 bits (536), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 124/387 (32%), Positives = 213/387 (55%), Gaps = 22/387 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M  T++R  +L+ L     ++ER+ T+PV  +VLL      L +  +  E+E+ G +   
Sbjct: 1   MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLTGTDLEVELVGRVTLE 60

Query: 61  VDVC--GSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEF 118
            D    G ITV A  L DI + L   A I    +++   ++ +  G S F L + P ++F
Sbjct: 61  -DAAEPGEITVPARKLMDICKSLPSDALIDIRVDDQ---KLLVKAGRSRFTLSTLPANDF 116

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P+ +E     +F L  + L+ L+ERT FAMA +++RYYLNG+   +    L+  AVATDG
Sbjct: 117 PTVEEGPGSLTFNLPQAKLRRLIERTSFAMAQQDVRYYLNGMLLEVQSGMLR--AVATDG 174

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA+  ++   Q      +IVPRK + E+ R+L+ +D+ V + L +  I  N    + +
Sbjct: 175 HRLAMCSMEAAIQQDGKHQVIVPRKGILELARLLTEQDAEVAIVLGQHHIRANTGEFTFT 234

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +L+DG+FP+Y+ V+P   DK +  +   LR+A  R +I+S+ + + ++L+L++  L + 
Sbjct: 235 SKLVDGKFPDYERVLPRGGDKLVLADRQGLREAFSRTAILSNEKYRGIRLTLAAGLLKIQ 294

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
            +NP+  +A E + V Y    ++I FN  YLL+++  + +     ++V   L  SNSS  
Sbjct: 295 ANNPEQEEAEEEIVVDYAGGGLEIGFNVSYLLDVLGVMGT-----EQVRLILSDSNSSAL 349

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           ++  D D         ++ YV+MPMR+
Sbjct: 350 LQEADND---------DSAYVVMPMRL 367


>gi|126668222|ref|ZP_01739183.1| DNA polymerase III, beta subunit [Marinobacter sp. ELB17]
 gi|126627371|gb|EAZ98007.1| DNA polymerase III, beta subunit [Marinobacter sp. ELB17]
          Length = 351

 Score =  211 bits (536), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 118/367 (32%), Positives = 201/367 (54%), Gaps = 20/367 (5%)

Query: 20  IIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAI-PASVDVCGSITVSAHLLYDIV 78
           ++E+K T+PV  +VLL A D  L +  +  E+E+   I P  +D  G ITV A  L DI 
Sbjct: 4   VVEKKQTMPVLSNVLLVAEDNTLTLTGTNMEVELVARITPVHIDQPGRITVPARKLADIC 63

Query: 79  RKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPSTKEEEYVYSFELASSVLK 138
           R L + + I     ++ G  +++  G S+F L + P   FP+ ++E   +  EL    L+
Sbjct: 64  RALGEESPIEL---DQQGDRLHLRCGKSHFTLATLPAEHFPNVEDEAESFRLELPQKELR 120

Query: 139 NLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAVAEVDIVAQIAKMPSI 198
            + + T FAMA +++RYYLNG+   +  + ++   VATDGHRLA+A  D+     +   +
Sbjct: 121 RMFDSTAFAMAQQDVRYYLNGLLLEVAADHVR--TVATDGHRLAMAHQDVETGCPEARQV 178

Query: 199 IVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLIDGEFPNYQNVIPCSND 258
           IVPRK V E+ R+L   D+ V + + ++ +   + S + + +LI+G+FP+Y  VIP   D
Sbjct: 179 IVPRKGVLELARLLDDVDTPVTLVIGDNHLRATVGSYTFTSKLIEGKFPDYNRVIPRGGD 238

Query: 259 KELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPDMGKAIESMNVYYNEC 318
           K +  +   L+  + R  I+S   I+ V+L+L++++L +  +NPD  +A +++ V Y   
Sbjct: 239 KVVLADRITLKNTLQRAGILSHENIRGVRLNLAANELQVFANNPDQEQAEDALPVDYQGE 298

Query: 319 PMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIRGKDKDSKNNKDNKVNAFY 378
            + I FN  YL+++++ +      DD+V   L + NSS  I  +               Y
Sbjct: 299 TLQIGFNVGYLIDVMNALD-----DDQVKVTLSNPNSSALIESQ---------TDARCLY 344

Query: 379 VLMPMRI 385
           V+MPMR+
Sbjct: 345 VVMPMRL 351


>gi|152987905|ref|YP_001345398.1| DNA polymerase III subunit beta [Pseudomonas aeruginosa PA7]
 gi|150963063|gb|ABR85088.1| DNA polymerase III, beta subunit [Pseudomonas aeruginosa PA7]
          Length = 367

 Score =  210 bits (535), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 129/391 (32%), Positives = 214/391 (54%), Gaps = 30/391 (7%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITG-AIPA 59
           M  T++R  +L+ L     ++ER+ T+PV  +VLL      L +  +  E+E+ G  +  
Sbjct: 1   MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLTGTDLEVELVGRVVLE 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G ITV A  L DI + L     I    E +   ++ +  G S F L + P ++FP
Sbjct: 61  DAAEPGEITVPARKLMDICKSLPSDVLIDIRVEEQ---KLLVKAGRSRFTLSTLPANDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + +E     +F +A S L+ L++RT FAMA +++RYYLNG+   +N   L+  +VATDGH
Sbjct: 118 TVEEGPGSLNFSIAQSKLRRLIDRTSFAMAQQDVRYYLNGMLLEVNGGALR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPS-----IIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIES 234
           RLA+  +D     A++PS     +IVPRK + E+ R+L+ +D  V + L +  I      
Sbjct: 176 RLAMCSLD-----AQIPSQDRHQVIVPRKGILELARLLTEQDGEVGIVLGQHHIRATTGE 230

Query: 235 LSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDK 294
            + + +L+DG+FP+Y+ V+P   DK +  +   LR+A  R +I+S+ + + ++L LS+  
Sbjct: 231 FTFTSKLVDGKFPDYERVLPRGGDKLVIGDRQQLREAFSRTAILSNEKYRGIRLQLSNGL 290

Query: 295 LCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSN 354
           L +  +NP+  +A E + V YN   ++I FN  YLL+++  I +     ++V F L  SN
Sbjct: 291 LKIQANNPEQEEAEEEVQVEYNGGNLEIGFNVSYLLDVLGVIGT-----EQVRFILSDSN 345

Query: 355 SSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           SS  +   D D         ++ YV+MPMR+
Sbjct: 346 SSALVHEADND---------DSAYVVMPMRL 367


>gi|120596835|ref|YP_961409.1| DNA polymerase III subunit beta [Shewanella sp. W3-18-1]
 gi|146291113|ref|YP_001181537.1| DNA polymerase III subunit beta [Shewanella putrefaciens CN-32]
 gi|120556928|gb|ABM22855.1| DNA polymerase III, beta subunit [Shewanella sp. W3-18-1]
 gi|145562803|gb|ABP73738.1| DNA polymerase III, beta subunit [Shewanella putrefaciens CN-32]
 gi|319424419|gb|ADV52493.1| DNA polymerase III, beta subunit [Shewanella putrefaciens 200]
          Length = 366

 Score =  210 bits (535), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 122/386 (31%), Positives = 220/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK +++R  +L+ L   C  +ER++ +P+  ++L++ +   L++  +  E+E+ G     
Sbjct: 1   MKFSIDRDALLKPLQLVCGAVERRHNLPILSNLLVEVSGHSLKLTGTDLEVELVGQAVVH 60

Query: 61  VDVC-GSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D+  G  TV A  L DIV+ L + +++   +++    +  +  G S F L + P  E+P
Sbjct: 61  GDIEEGRTTVPAKKLLDIVKSLPEQSELKVEQQD---NKWLLRSGRSRFSLATLPAEEYP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + +  +    F L   VLK++++ T F+MA +++RYYLNG+ F    E   L A+ATDGH
Sbjct: 118 NVEAFQAEIEFSLKQGVLKSIIDSTQFSMANQDVRYYLNGLLFET--EGNMLRAIATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA++   I AQ+ +   +IVPRK V E+ R+L S D  + +++ ++ I     +   + 
Sbjct: 176 RLALSHRVIDAQLPE-KQVIVPRKGVMEMARLLESDDLDIAIAIGDNAIRATTANTVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P   DK +  +  +L+QA+ R SI+S+ + + V++ L +  L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKGGDKIVIASRNHLKQALTRASILSNEKFRGVRIQLENGLLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V YN   ++I FN  YLL++++N+ S     D+V   L   NSS  I
Sbjct: 295 NNPEQEEAEEIIDVDYNNQSLEIGFNVSYLLDVLNNLKS-----DDVRITLIDGNSSALI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
               ++         ++ YV+MPMR+
Sbjct: 350 ENHLEE---------DSMYVVMPMRL 366


>gi|86147176|ref|ZP_01065492.1| DNA polymerase III subunit beta [Vibrio sp. MED222]
 gi|85835060|gb|EAQ53202.1| DNA polymerase III subunit beta [Vibrio sp. MED222]
          Length = 366

 Score =  210 bits (535), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 115/386 (29%), Positives = 214/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ERS +++ L      +  + T+P+  ++L++  D +L + A+  E+E+   +   
Sbjct: 1   MKFTIERSHLIKPLQQVSGALGGRPTLPILGNLLIKVEDNVLSMTATDLEVELISRVTLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D   GSITV +    DI R L D + I+   +   G  + +  G S F L + P ++FP
Sbjct: 61  GDFEAGSITVPSRKFLDICRGLPDSSVITVVLD---GDRIQVRSGRSRFSLATLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++        +  + L+ L+E+T F+MA +++RYYLNG+ F I    L+  +VATDGH
Sbjct: 118 NIEDWSSEVEVSVTQAELRGLIEKTQFSMANQDVRYYLNGMLFEIEGSILR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AV++  + A  A+   IIVPRK V E++++L + +  V + +  S +   + +   + 
Sbjct: 176 RMAVSQAQLGADFAQ-KQIIVPRKGVQELVKLLDAPEQPVTLQIGNSNVRAEVNNYVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P +  K L   C  LR A  R +I+S+ + + V+++L   ++ +T 
Sbjct: 235 KLVDGRFPDYRRVMPQNTTKTLEAGCDELRSAFSRAAILSNEKFRGVRVNLVDSEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V ++   ++I FN  Y+L++++ +       ++V   +  +N+S  I
Sbjct: 295 NNPEQEEAEEVLDVTFDGDALEIGFNVSYVLDVLNTLRC-----EQVRISMSDANASALI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
                DS         A YV+MP+R+
Sbjct: 350 ENAQDDS---------AMYVVMPIRL 366


>gi|218708099|ref|YP_002415720.1| DNA polymerase III subunit beta [Vibrio splendidus LGP32]
 gi|218321118|emb|CAV17068.1| DNA polymerase III beta subunit [Vibrio splendidus LGP32]
          Length = 366

 Score =  210 bits (534), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 116/386 (30%), Positives = 214/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK T+ERS +++ L      +  + T+P+  ++L++  D +L + A+  E+E+   +   
Sbjct: 1   MKFTIERSHLIKPLQQVSGALGGRPTLPILGNLLIKVEDNVLSMTATDLEVELISRVTLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D   GSITV +    DI R L D + I+   +   G  + +  G S F L + P ++FP
Sbjct: 61  GDFEAGSITVPSRKFLDICRGLPDSSVITVVLD---GDRIQVRSGRSRFSLATLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++        +  + L+ L+E+T F+MA +++RYYLNG+ F I  E   L +VATDGH
Sbjct: 118 NIEDWSSEVEVSVTQAELRGLIEKTQFSMANQDVRYYLNGMLFEI--EGSILRSVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AV++  + A  A+   IIVPRK V E++++L + +  V + +  S +   + +   + 
Sbjct: 176 RMAVSQAQLGADFAQ-KQIIVPRKGVQELVKLLDAPEQPVTLQIGNSNVRAEVNNYVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P +  K L   C  LR A  R +I+S+ + + V+++L   ++ +T 
Sbjct: 235 KLVDGRFPDYRRVMPQNTTKTLEAGCDELRSAFSRAAILSNEKFRGVRVNLVDSEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V ++   ++I FN  Y+L++++ +       ++V   +  +N+S  I
Sbjct: 295 NNPEQEEAEEVLDVNFDGDALEIGFNVSYVLDVLNTLRC-----EQVRISMSDANASALI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
                DS         A YV+MP+R+
Sbjct: 350 ENAQDDS---------AMYVVMPIRL 366


>gi|294138803|ref|YP_003554781.1| DNA polymerase III subunit beta [Shewanella violacea DSS12]
 gi|293325272|dbj|BAJ00003.1| DNA polymerase III, beta subunit [Shewanella violacea DSS12]
          Length = 366

 Score =  209 bits (533), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 122/387 (31%), Positives = 218/387 (56%), Gaps = 23/387 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK +++R  +L+ L      +ER++ +P+  ++L++ +   L++  +  E+E+ G +   
Sbjct: 1   MKFSIDRDALLKPLQLVNGAVERRHNLPILANLLVEVSGHSLKMTGTDLEVELVGQVQLE 60

Query: 61  VDVC-GSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESEF 118
            DV  G ITV A    DIV+ L D  ++    +EN L     +  G S F L + P  E+
Sbjct: 61  GDVVEGRITVPAKKFLDIVKSLPDQVELKIEQQENRL----LLRSGRSRFTLATLPAEEY 116

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P+ +  +    F +    LK+L++ T F+MA +++RYYLNG+    +   L+  A+ATDG
Sbjct: 117 PNVEAFQSDIEFTIKQGTLKSLIDATQFSMANQDVRYYLNGLLLETDGNVLR--AIATDG 174

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA++   I A + +   +IVPRK V E+ R+   +D  V +++ ++ I     S  ++
Sbjct: 175 HRLALSHRQIEATLPE-KQVIVPRKGVVELQRLFEGEDLDVTIAIGDNAIRATTSSAVLT 233

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +L+DG FP+Y+ V+P   DK +  +   L+QA+ R SI+S+ + + V++ L ++ L +T
Sbjct: 234 SKLVDGRFPDYRRVLPKGGDKVVIASRNQLKQALLRASILSNEKFRGVRVQLENNLLKIT 293

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
            +NP+  +A E ++V Y+  P++I FN  YLL++++N+ S     D+V   L   NSS  
Sbjct: 294 ANNPEQEEAEEIIDVEYDNTPLEIGFNVSYLLDVLNNLPS-----DDVRITLIDGNSSAL 348

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           I    ++         ++ YV+MPMR+
Sbjct: 349 IENHIEE---------DSMYVVMPMRL 366


>gi|119503574|ref|ZP_01625657.1| DNA polymerase III subunit beta [marine gamma proteobacterium
           HTCC2080]
 gi|119460636|gb|EAW41728.1| DNA polymerase III subunit beta [marine gamma proteobacterium
           HTCC2080]
          Length = 365

 Score =  209 bits (533), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 126/386 (32%), Positives = 212/386 (54%), Gaps = 22/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK ++ R  +++ L     ++ER+ T+P+  +VLL      L +  +  E+E+ G +   
Sbjct: 1   MKFSISREALIKPLNLVAGVVERRQTLPILSNVLLNLEGTQLSLTGTDLEVELIGRVEVE 60

Query: 61  VD-VCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
              V G ITV A  L DI + L D +QI F  ++    +  +  G   F L + P +EFP
Sbjct: 61  AGGVDGDITVPARKLVDICKSLPDSSQIEFSVDS---GKAMVKAGRGRFTLSTLPATEFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           S  E     + E+A SV+K L++RT FAMA +++RYYLNG+   +    L++  VATDGH
Sbjct: 118 SVDESAGDQTLEVAQSVVKRLIDRTAFAMAQQDVRYYLNGMLLELKAGRLRM--VATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA+   +         +II+PRK V E+ R+L + D S+++ +  + I    +  + + 
Sbjct: 176 RLALCTANEAVSTGD-AAIIIPRKGVLELSRLLDT-DESIRLVIGSNHIRAANQQFTFTS 233

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG+FP Y+ V+P S DK +      LRQA  R +I+S+ + + V+L LS+D L +T 
Sbjct: 234 KLVDGKFPEYERVLPKSADKTVIGQRLELRQAFTRTAILSNEKYRGVRLKLSADTLDITA 293

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E + V Y    +++ FN  YLL+++  +  D++       RL  S+S+   
Sbjct: 294 NNPEQEQAEEVVAVEYQGEELEVGFNVSYLLDVLSVLDGDQI-------RLSLSDSASSA 346

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             ++ D         ++ YV+MPMR+
Sbjct: 347 LLEEADEG-------DSLYVVMPMRL 365


>gi|49086146|gb|AAT51331.1| PA0002 [synthetic construct]
          Length = 368

 Score =  209 bits (533), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 129/391 (32%), Positives = 214/391 (54%), Gaps = 30/391 (7%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITG-AIPA 59
           M  T++R  +L+ L     ++ER  T+PV  +VLL      L +  +  E+E+ G  +  
Sbjct: 1   MHFTIQREALLKPLQLVAGVVERLQTLPVLSNVLLVVEGQQLSLTGTDLEVELVGRVVLE 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G ITV A  L DI + L +   I    E +   ++ +  G S F L + P ++FP
Sbjct: 61  DAAEPGEITVPARKLMDICKSLPNDVLIDIRVEEQ---KLLVKAGRSRFTLSTLPANDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + +E     +F +A S L+ L++RT FAMA +++RYYLNG+   +N   L+  +VATDGH
Sbjct: 118 TVEEGPGSLNFSIAQSKLRRLIDRTSFAMAQQDVRYYLNGMLLEVNGGTLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPS-----IIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIES 234
           RLA+  +D     A++PS     +IVPRK + E+ R+L+ +D  V + L +  I      
Sbjct: 176 RLAMCSLD-----AQIPSQDRHQVIVPRKGILELARLLTEQDGEVGIVLGQHHIRATTGE 230

Query: 235 LSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDK 294
            + + +L+DG+FP+Y+ V+P   DK +  +   LR+A  R +I+S+ + + ++L LS+  
Sbjct: 231 FTFTSKLVDGKFPDYERVLPRGGDKLVVGDRQQLREAFSRTAILSNEKYRGIRLQLSNGL 290

Query: 295 LCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSN 354
           L +  +NP+  +A E + V YN   ++I FN  YLL+++  I +     ++V F L  SN
Sbjct: 291 LKIQANNPEQEEAEEEVQVEYNGGNLEIGFNVSYLLDVLGVIGT-----EQVRFILSDSN 345

Query: 355 SSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           SS  +   D D         ++ YV+MPMR+
Sbjct: 346 SSALVHEADND---------DSAYVVMPMRL 367


>gi|91791371|ref|YP_561022.1| DNA polymerase III, beta subunit [Shewanella denitrificans OS217]
 gi|91713373|gb|ABE53299.1| DNA polymerase III, beta subunit [Shewanella denitrificans OS217]
          Length = 366

 Score =  209 bits (532), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 117/386 (30%), Positives = 222/386 (57%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK +++R  +L+ L      +ER++ +P+  ++L++ +  ++ +  +  E+E+ G     
Sbjct: 1   MKFSIDRDALLKPLQLVTGAVERRHNLPILANLLVKVSQDVISLTGTDLEVELVGQAAIH 60

Query: 61  VDVC-GSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D+  G+ TV A  L DIV+ L + +++   +++       +  G S F L + P S++P
Sbjct: 61  GDIVPGNTTVPAKKLLDIVKSLPEQSELHVEQQDNRWL---LRSGRSRFTLATLPASDYP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + +  +    F +   VLK++++ T F+MA +++RYYLNG+ F      LK  A+ATDGH
Sbjct: 118 NVEAFQAEIEFTIKQGVLKSIIDSTQFSMANQDVRYYLNGLLFETEGNTLK--AIATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA++   I   + +   +IVPRK V E+ R+L S D  + +++ ES I    ++   + 
Sbjct: 176 RLALSHRQIDVSLPE-KQVIVPRKGVVEMSRLLDSDDKDISIAIGESAIRAVTDTAVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P   DK +  +   L+QA+ R SI+S+ + + V++ L    L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKGGDKVVVASRQQLKQALTRASILSNEKFRGVRIQLEPGLLRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y+   ++I FN  YLL++++N++S++V     +  +D ++S++  
Sbjct: 295 NNPEQEEAEEIIDVDYDSANLEIGFNVSYLLDVLNNLASEDV----RITLIDGNSSALIE 350

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
             K++DS           YV+MPMR+
Sbjct: 351 NHKEEDS----------MYVVMPMRL 366


>gi|119475237|ref|ZP_01615590.1| DNA polymerase III subunit beta [marine gamma proteobacterium
           HTCC2143]
 gi|119451440|gb|EAW32673.1| DNA polymerase III subunit beta [marine gamma proteobacterium
           HTCC2143]
          Length = 368

 Score =  209 bits (532), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 119/387 (30%), Positives = 212/387 (54%), Gaps = 21/387 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITG--AIP 58
           MK  + R  +L+ L     ++ER+ T+P+  +VLL+     L I  +  E+E+ G   + 
Sbjct: 1   MKFVISREALLKPLNLVAGVVERRQTLPILSNVLLELEGNQLSITGTDLEVELVGRVVLD 60

Query: 59  ASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEF 118
            + +  G ITV A  L DI + L DG++I F ++++    V I  G S F L +   S+F
Sbjct: 61  QAPETGGEITVPARKLADICKSLPDGSEIEFTQDDQ---RVIIRSGRSRFTLSTLAASDF 117

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P+ +E      F +    LK L++RT FAMA +++RYYLNG+ + +    L++  VATDG
Sbjct: 118 PNVEESPGSQDFTVKQGDLKRLIDRTSFAMAQQDVRYYLNGMLWEVQSGQLRV--VATDG 175

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA+  +    +  +   +I+PRK V E+ R++  +   V++ +  + I    +  + +
Sbjct: 176 HRLALCTLATSIETTENLQVILPRKGVVELARLMMKESDDVRLVIGSNHIRATTDEYTFT 235

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +L+DG+FP+Y  V+P ++ K +  +   LRQA  R +I+S+ + + V+L LS+D L + 
Sbjct: 236 SKLVDGKFPDYDRVLPKASTKTIFGSRDELRQAFSRTAILSNEKYRGVRLLLSNDTLQIV 295

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
            +NP+  +A E ++V Y    ++I FN  YLL+++  +       + +   L  +NSS  
Sbjct: 296 ANNPEQEEAEEIVSVDYQGESLEIGFNVSYLLDVLGVLKG-----ETIKLSLADANSSAL 350

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +          +  + ++ YV+MPMR+
Sbjct: 351 L---------EESEEGDSMYVVMPMRL 368


>gi|226326919|ref|ZP_03802437.1| hypothetical protein PROPEN_00779 [Proteus penneri ATCC 35198]
 gi|225204756|gb|EEG87110.1| hypothetical protein PROPEN_00779 [Proteus penneri ATCC 35198]
          Length = 367

 Score =  209 bits (531), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 129/388 (33%), Positives = 215/388 (55%), Gaps = 24/388 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  +ER  +L+ L      +  + T+P+  ++LL+  +  L +  +  E+E+   +  S
Sbjct: 1   MKFIIEREQLLKPLQQVSGPLGGRPTLPILGNLLLKVTENTLSLTGTDLEMEMVARVNLS 60

Query: 61  VD-VCGSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEF 118
                G+ TV A   +DI R L +GA+IS     EL G  + +  G S F L + P S+F
Sbjct: 61  QSHEIGATTVPARKFFDIWRGLPEGAEISV----ELDGDRLLVRSGRSRFSLSTLPASDF 116

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P+  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+ +L  VATDG
Sbjct: 117 PNLDDWQSEVEFTLPQATLKRLIESTQFSMAHQDVRYYLNGMLFET--ENTELRTVATDG 174

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRIL-SSKDSSVKVSLSESRIHLNIESLSM 237
           HRLAV  +DI  Q     S+IVPRK V E++R+L    +SS+++ +  + I  ++     
Sbjct: 175 HRLAVCSMDI-GQSLPGHSVIVPRKGVIELMRLLDGGGESSLQLQIGSNNIRAHVGDFIF 233

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +L+DG FP+Y+ V+P +  K +   C  L+QA  R +I+S+ + + V+++L+S +L +
Sbjct: 234 TSKLVDGRFPDYRRVLPKNPTKTVIAGCDILKQAFSRAAILSNEKFRGVRINLTSGQLKI 293

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           T +NP+  +A E ++V Y    M+I FN  YLL++++ +       +EV   L  + SSV
Sbjct: 294 TANNPEQEEAEEIVDVQYQGEEMEIGFNVSYLLDVLNTLKC-----EEVKLLLTDAVSSV 348

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            +      +         A YV+MPMR+
Sbjct: 349 QVENVASSA---------AAYVVMPMRL 367


>gi|308047724|ref|YP_003911290.1| DNA polymerase III, beta subunit [Ferrimonas balearica DSM 9799]
 gi|307629914|gb|ADN74216.1| DNA polymerase III, beta subunit [Ferrimonas balearica DSM 9799]
          Length = 366

 Score =  208 bits (530), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 123/386 (31%), Positives = 205/386 (53%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+  + R  +L+ L      +ER++ +P+  +VLL+ +  LL++  +  E+E+ G +   
Sbjct: 1   MQFVINRETLLKPLQLVSGAVERRHNLPILANVLLEVSGNLLKVTGTDLEVELIGQVEVE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D+  G  TV A    DI + L D A++   +++     + I  G S F L + P  EFP
Sbjct: 61  GDIQPGRTTVPARKFLDICKSLPDQAELRIEQQD---NRLLIKSGRSRFSLSTLPADEFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
              + +    F L   VLK+L+E T F+MA +++RYYLNG+ F      L+   VATDGH
Sbjct: 118 EIGDWKGELQFTLPQGVLKSLIEATQFSMAHQDVRYYLNGMLFETEGNVLR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV+   I A + +   +IVPRK V E+ R+   + + + + + ES I         + 
Sbjct: 176 RLAVSHRVIEASLPEK-QVIVPRKGVIELSRLFEDEQAEITLCIGESSIRAVTRDAIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P   DK +      LRQA  R SI+S+ + + V+L L +D+L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKDGDKVVVAERDALRQAFARASILSNEKFRGVRLLLENDRLTITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E +++ Y    ++I FN  Y+L++++ +       + V   L  +NSS   
Sbjct: 295 NNPEQEEAEEVLDLAYPYTSLEIGFNVSYVLDVLNALKQ-----ENVKMVLGEANSSALF 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              D D          + YV+MPMR+
Sbjct: 350 ENADNDE---------SLYVVMPMRL 366


>gi|28197947|ref|NP_778261.1| DNA polymerase III subunit beta [Xylella fastidiosa Temecula1]
 gi|182680574|ref|YP_001828734.1| DNA polymerase III subunit beta [Xylella fastidiosa M23]
 gi|28056007|gb|AAO27910.1| DNA polymerase III beta chain [Xylella fastidiosa Temecula1]
 gi|182630684|gb|ACB91460.1| DNA polymerase III, beta subunit [Xylella fastidiosa M23]
 gi|307579028|gb|ADN62997.1| DNA polymerase III subunit beta [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 366

 Score =  208 bits (529), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 122/385 (31%), Positives = 210/385 (54%), Gaps = 19/385 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+  ++R   L+ L H   ++ER+ T  +  ++L++ N+  L +  +  E+E+       
Sbjct: 1   MRFRLQRETFLKPLAHVVNVVERRQTRSILANLLIKVNEDQLSLTGTDLEVEMISKTKIE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               G IT+ A  +Y+IVR L D +Q+S ++ ++   ++ +  G S F L + P ++FPS
Sbjct: 61  DPESGEITIPARKIYEIVRALPDASQLSVYQSDD---KITLQAGRSRFTLATLPANDFPS 117

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
             + E      +A  +LK L+ERT FAMA +++RYYLNG+ F +   D KL  VATDGHR
Sbjct: 118 IDKIEVTERIIIAEVLLKELIERTAFAMAQQDVRYYLNGLLFDLR--DTKLRCVATDGHR 175

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LA+ E ++         II+PRK V E+ R+L   D  +++ ++ + I +    ++ + +
Sbjct: 176 LALCETELEQAKDLKRQIILPRKGVMELQRLLEGSDRQIELEIARNHIRMKSFDVTFTSK 235

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDG FP+Y+ VIP   D+E++V    LR A+ R +I+S+ + + V++ +S  +L +   
Sbjct: 236 LIDGSFPDYEGVIPIGADREVKVAREVLRDALQRAAILSNEKYRGVRIEVSPGQLKINAH 295

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           NP+  +A E +        + I FN  YLL+ + ++       D V  +L  SNSS  IR
Sbjct: 296 NPEQEEAQEEIEAQTIVDGLAIGFNVNYLLDALSSLRG-----DFVNIQLRDSNSSALIR 350

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
                    + N   +  V+MP+R+
Sbjct: 351 ---------ESNSEKSLQVVMPLRL 366


>gi|119947309|ref|YP_944989.1| DNA polymerase III, beta subunit [Psychromonas ingrahamii 37]
 gi|119865913|gb|ABM05390.1| DNA polymerase III, beta subunit [Psychromonas ingrahamii 37]
          Length = 367

 Score =  208 bits (529), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 119/363 (32%), Positives = 211/363 (58%), Gaps = 21/363 (5%)

Query: 24  KNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-ASVDVCGSITVSAHLLYDIVRKLQ 82
           +  +P+  ++L++  D  L +  +  E+E+   I   +    G ITV A  L DI R L 
Sbjct: 25  RPALPIMANILIEVKDNQLSLTGTDLEVELIAVIALENPSENGVITVPARKLLDICRGLS 84

Query: 83  DGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPSTKEEEYVYSFELASSVLKNLVE 142
           +  +I F  + E   +V I  G S + L S P  +FP+ +  + +    +  +  K L+E
Sbjct: 85  EPCEIKFQVKEE---KVTIRSGRSRYLLSSLPAVDFPNIESWQSLVELTVPQAEFKKLIE 141

Query: 143 RTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAVAEVDIVAQIAKMPSIIVPR 202
            T FAMA++++RYYLNG++F  +E+ L+  +VATDGHRLA   + +  Q+ +  S+IVPR
Sbjct: 142 FTQFAMASQDVRYYLNGMYFEASEQTLR--SVATDGHRLASCSIKL-NQVIEQQSVIVPR 198

Query: 203 KAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLIDGEFPNYQNVIPCSNDKELR 262
           K V E++++L +  ++V + + ++ +   I+    + +L+DG FP+Y+ VIP + DKEL 
Sbjct: 199 KGVIELVKLLDNDQANVTIQIGQNNLRAVIDGFIFTTKLVDGRFPDYRRVIPKNGDKELI 258

Query: 263 VNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPDMGKAIESMNVYYNECPMDI 322
            N  +L+QA  R +I+S+ + + V+L LS + L +T +NP+  +A E ++V Y+   ++I
Sbjct: 259 SNRESLKQAFSRAAILSNEKFRGVRLILSENLLQITANNPEREEAEEYIDVDYHSANLEI 318

Query: 323 CFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIRGKDKDSKNNKDNKVNAFYVLMP 382
            FN  Y+L++++ + S++V   ++ F   +S+ S  I   D D         ++ YVLMP
Sbjct: 319 GFNVSYVLDVLNTLKSEQV---KITF--SNSDHSALIESIDSD---------DSLYVLMP 364

Query: 383 MRI 385
           MR+
Sbjct: 365 MRL 367


>gi|77456230|ref|YP_345735.1| DNA polymerase III subunit beta [Pseudomonas fluorescens Pf0-1]
 gi|77380233|gb|ABA71746.1| DNA polymerase III, beta chain [Pseudomonas fluorescens Pf0-1]
          Length = 367

 Score =  208 bits (529), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 128/391 (32%), Positives = 217/391 (55%), Gaps = 30/391 (7%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAI--- 57
           M  T++R  +L+ L     ++ER+ T+PV  +VLL  +   L +  +  E+E+ G +   
Sbjct: 1   MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVDGQQLSLTGTDLEVELVGRVQLE 60

Query: 58  -PASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPES 116
            PA     GSITV A  L DI + L + A I    + +   ++ +  G S F L + P +
Sbjct: 61  EPAE---TGSITVPARKLMDICKSLPNDALIDIKVDEQ---KLVVKAGRSRFTLSTLPAN 114

Query: 117 EFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVAT 176
           +FP+ +E     +  L  S L+ L+ERT FAMA +++RYYLNG+   ++   ++  AVAT
Sbjct: 115 DFPTVEEGPGSLTTSLEQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVSTGVIR--AVAT 172

Query: 177 DGHRLAV--AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIES 234
           DGHRLA+   + DI  Q      +IVPRK + E+ R+L+  D +V + L +  I      
Sbjct: 173 DGHRLAMCSMQADIGQQ--DRHQVIVPRKGILELARLLTEPDGNVSIVLGQHHIRATTGE 230

Query: 235 LSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDK 294
            + + +L+DG+FP+Y+ V+P   DK +  +   LR+A  R +I+S+ + + ++L L+S +
Sbjct: 231 FTFTSKLVDGKFPDYERVLPKGGDKLVLGDRQALREAFSRTAILSNEKYRGIRLQLASGQ 290

Query: 295 LCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSN 354
           L +  +NP+  +A E + V YN   ++I FN  YLL+++  +++     ++V   L  SN
Sbjct: 291 LKIQANNPEQEEAEEEVGVEYNGGSLEIGFNVSYLLDVLGVMTT-----EQVRLILSDSN 345

Query: 355 SSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           SS  ++  D D         ++ YV+MPMR+
Sbjct: 346 SSALVQESDND---------DSAYVVMPMRL 367


>gi|163759228|ref|ZP_02166314.1| DNA polymerase III, beta chain protein [Hoeflea phototrophica
           DFL-43]
 gi|162283632|gb|EDQ33917.1| DNA polymerase III, beta chain protein [Hoeflea phototrophica
           DFL-43]
          Length = 385

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 130/397 (32%), Positives = 221/397 (55%), Gaps = 32/397 (8%)

Query: 3   ITVERSDILELLGHACRIIERKNTIPVSCHVLLQ--ANDGLLEIKASGPEIEITGAIPAS 60
           +T  R+ +L  +  A   +ER+NTIPV  ++LL+  A+DGL   + SG ++++   +   
Sbjct: 7   LTAPRAALLAAVETALGAVERRNTIPVLANLLLESTADDGL---RVSGTDLDVMTTVATG 63

Query: 61  VDV----CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPES 116
           +D        +T+ AHLL+DI+RKL D A++S   +     ++ ++ G S F LQ+ P +
Sbjct: 64  LDAEPRQYAGVTLPAHLLHDILRKLPDKAEVSLKTDGS--GQMTLTSGRSRFNLQTLPGA 121

Query: 117 EFPSTKEEEY-VYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVA 175
           ++P  +E+     +FE+ ++     +    FA++TEE RYYLNG++ H    D +L  VA
Sbjct: 122 DWPRLQEKTAPAATFEIPAAKFAAQLAAVGFAISTEETRYYLNGVYMH--AIDNRLVTVA 179

Query: 176 TDGHRLA----VAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVK--VSLSESRIH 229
           TDGHRLA     A V ++     MP II+PRK VG + + L++        +++SE+ I 
Sbjct: 180 TDGHRLARAVYSAAVGVMPAADAMPGIIIPRKTVGLVAKALAAAAKDATLAIAVSENMIS 239

Query: 230 LNIESLSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLS 289
             + +  ++ +LIDG FP+Y+ VIP +N    R +   L QA +RVSI+SS R +AVK++
Sbjct: 240 FELGATRIASKLIDGTFPDYERVIPIANPNSWRFDVAALLQATERVSIISSERGRAVKMA 299

Query: 290 LSSDKLCMTVDNPDMGKAIESMNVYYNEC-PMDICFNYKYLLEIIDNISSDEVVDDEVVF 348
              + + +TV NPD G+  + ++V  +    ++I FN KYL +++ ++S    V      
Sbjct: 300 WGRESIDLTVINPDAGEGQDQVSVDADTGEEVEIGFNAKYLADMLGHMSKSGSV------ 353

Query: 349 RLDSSNSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            L++            D     D+++   +VLMPMR+
Sbjct: 354 HLNTGGDPARFEPVHAD-----DDEIAMTFVLMPMRV 385


>gi|42520873|ref|NP_966788.1| DNA polymerase III, beta subunit [Wolbachia endosymbiont of
           Drosophila melanogaster]
 gi|42410613|gb|AAS14722.1| DNA polymerase III, beta subunit [Wolbachia endosymbiont of
           Drosophila melanogaster]
          Length = 365

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 129/384 (33%), Positives = 217/384 (56%), Gaps = 20/384 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ +V R+ +L  L     ++ER+N I V   + ++A  G +++ A+  +I +  ++ A+
Sbjct: 1   MRFSVSRTSLLNTLSRVSGVVERRNAIDVFACINIKAQHGSIKLMATDLDISMFASLAAT 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V   G + +SAH L+DIV+KL     ++F   N+   ++ +S G++NF L +   S FP+
Sbjct: 61  VLTEGEVKISAHTLHDIVKKLPADLDVNFEVNNQ--GKLLMSCGNANFSLPNVVSSSFPA 118

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
            +E+ Y + F L ++ L +L+ +T FA++ ++ RY LNGI+ H +E+   L  VATDGHR
Sbjct: 119 LEEDNYKHDFTLLNTDLIDLLTKTKFAVSLDDTRYNLNGIYLHTDEQ--FLYCVATDGHR 176

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           L+  +      I     +I+PRK V E+L+IL   +  +KV LS+ +I        +  +
Sbjct: 177 LSCIKRPKPGNINGEFGVIIPRKTVMELLKILDDCNE-IKVKLSDRKIKFTCGEYILISK 235

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDG FPNY+ VIP S DK + +    L   +DRVS++ S +++++K SL    L +  +
Sbjct: 236 LIDGTFPNYKAVIPASQDKHMIIESKKLSDVIDRVSVVVSDKVKSIKFSLQEKLLTLHSN 295

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           + +   A ES+ V YNE P++I FN +YLL+++        + ++  F L   NS+  I 
Sbjct: 296 SQECSDATESIEVDYNEAPIEIGFNSRYLLDVL------SCIKNKCKFSLADGNSATIIT 349

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMR 384
            +D  S         A YV+MPMR
Sbjct: 350 DEDDSS---------ALYVVMPMR 364


>gi|71275533|ref|ZP_00651819.1| DNA polymerase III, beta chain [Xylella fastidiosa Dixon]
 gi|71900180|ref|ZP_00682320.1| DNA polymerase III, beta chain [Xylella fastidiosa Ann-1]
 gi|170729253|ref|YP_001774686.1| DNA polymerase III subunit beta [Xylella fastidiosa M12]
 gi|71163833|gb|EAO13549.1| DNA polymerase III, beta chain [Xylella fastidiosa Dixon]
 gi|71730069|gb|EAO32160.1| DNA polymerase III, beta chain [Xylella fastidiosa Ann-1]
 gi|167964046|gb|ACA11056.1| DNA-directed DNA polymerase [Xylella fastidiosa M12]
          Length = 366

 Score =  207 bits (527), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 122/385 (31%), Positives = 210/385 (54%), Gaps = 19/385 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+  ++R   L+ L H   ++ER+ T  +  ++L++ N+  L +  +  E+E+       
Sbjct: 1   MRFRLQRETFLKPLAHVVNVVERRQTRSILANLLIKVNEDQLSLTGTDLEVEMISKTIIE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               G IT+ A  +Y+IVR L D +Q+S ++ ++   ++ +  G S F L + P ++FPS
Sbjct: 61  DAESGEITIPARKIYEIVRALPDASQLSVYQSDD---KITLQAGRSKFTLATLPANDFPS 117

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
             + E      +A  +LK L+ERT FAMA +++RYYLNG+ F +   D KL  VATDGHR
Sbjct: 118 IDKIEVTERIIIAEVLLKELIERTAFAMAQQDVRYYLNGLLFDLR--DTKLRCVATDGHR 175

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LA+ E ++         II+PRK V E+ R+L   D  +++ ++ + I +    ++ + +
Sbjct: 176 LALCETELEQAKDLKRQIILPRKGVMELQRLLEGSDRQIELEIARNHIRMKSFDVTFTSK 235

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDG FP+Y+ VIP   D+E++V    LR A+ R +I+S+ + + V++ +S  +L +   
Sbjct: 236 LIDGSFPDYEGVIPIGADREVKVAREVLRDALQRAAILSNEKYRGVRIEVSPGQLKINAH 295

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           NP+  +A E +        + I FN  YLL+ + ++       D V  +L  SNSS  IR
Sbjct: 296 NPEQEEAQEEIEAQTIVDGLAIGFNVNYLLDALSSLRG-----DFVNIQLRDSNSSALIR 350

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
                    + N   +  V+MP+R+
Sbjct: 351 ---------ESNSEKSLQVVMPLRL 366


>gi|254784275|ref|YP_003071703.1| DNA polymerase III subunit beta [Teredinibacter turnerae T7901]
 gi|237687276|gb|ACR14540.1| DNA polymerase III, beta subunit [Teredinibacter turnerae T7901]
          Length = 367

 Score =  207 bits (526), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 124/387 (32%), Positives = 212/387 (54%), Gaps = 22/387 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MK TV R  +++ L     ++ER+ T+ V  +VL++     L +  +  E+EI G +   
Sbjct: 1   MKFTVSREALIKPLQLVAGVVERRQTMAVLANVLMEIEGDQLSLTGTDLEVEIIGRVQLE 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
           S    G ITV A    DI R L D + I F  +++  T   +  G S F L + P +EFP
Sbjct: 61  SAPGNGEITVPAKKFLDICRSLPDKSVIEFSLQDQKAT---VKSGKSRFTLSTLPANEFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++     +       +K L++RT FAMA +++RYYLNG+ + +   ++++  VATDGH
Sbjct: 118 AVEQGSNDINISCEQKEIKRLIDRTAFAMAQQDVRYYLNGMLWELRPGEIRV--VATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV    +   ++++   I+PRK V E+ R+L+  +  V+VSL  S +  +    + + 
Sbjct: 176 RLAVCSRPVDVDVSEIKQAILPRKGVIELARLLNDSEDGVEVSLGSSHMRASTAEYTFTS 235

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG+FP+Y+ V+P   DK +  N ++L+QA  R SI+S+ + + V+L L +  L +  
Sbjct: 236 KLVDGKFPDYERVLPKGGDKVVLGNRSDLKQAFARTSILSNEKYRGVRLELVAGSLTIIA 295

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDE-VVFRLDSSNSSVF 358
           +NP+  +A + + V YN   +++ FN  YL ++ +      V+D E +   L  SNSS  
Sbjct: 296 NNPEQEEAQDQVEVDYNGDALEVGFNVSYLQDVAN------VLDSENIKITLSDSNSSAL 349

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +     +   N D+     YV+MPMR+
Sbjct: 350 L-----EEPENSDSS----YVVMPMRL 367


>gi|254363201|ref|ZP_04979250.1| DNA-directed DNA polymerase III beta subunit [Mannheimia
           haemolytica PHL213]
 gi|153095095|gb|EDN75646.1| DNA-directed DNA polymerase III beta subunit [Mannheimia
           haemolytica PHL213]
          Length = 367

 Score =  207 bits (526), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 127/388 (32%), Positives = 217/388 (55%), Gaps = 24/388 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEIT--GAIP 58
           M+IT+ R  +L+ L   C ++  + T+PV  ++LL+     L +  +  E+E+T    + 
Sbjct: 1   MQITITREQLLKPLQQVCGVLSSRPTLPVINNLLLEIEGNRLSLTGTDLEVELTTQAQLL 60

Query: 59  ASVDVCGSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESE 117
            +VD  G  T+ A    DI + L D + IS  F+E++      I  G S F L + P S+
Sbjct: 61  QAVDFAGKFTIPAKKFLDISKSLPDDSVISVQFEEDK----AIIKAGRSKFSLATLPASD 116

Query: 118 FPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATD 177
           +P+  + +    F +  S L  L++ T F+MA ++ RY+LNG+ F      L+   VATD
Sbjct: 117 YPNLMDWKPEVDFSIDQSTLARLIDATQFSMANQDARYFLNGMKFETEGNLLR--TVATD 174

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLAV  + ++ Q     S+IVPRKAV E+ R+++S D +V++ +  S I + +  +  
Sbjct: 175 GHRLAVCTM-VLNQELLTHSVIVPRKAVLELSRLVASNDETVRLEIGSSNIRITMNGIVF 233

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +LIDG FP+Y+ V+P + D+ L      L++A+ R +I+S+ + + V+L+LS++ L +
Sbjct: 234 TSKLIDGRFPDYRRVLPRNADRILEAETETLKRALMRAAILSNEKFRGVRLTLSNNLLKI 293

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           T +NP+  +A E ++V Y+   M++ FN  Y+L++++ +         V F L  S+SS 
Sbjct: 294 TANNPEQEEAEEIIDVAYDSPEMEVGFNVSYVLDVLNTLKC-----QRVRFSLVDSSSSC 348

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            I   D  S         A YV+MPMR+
Sbjct: 349 LIEDCDNSS---------AEYVIMPMRL 367


>gi|261493281|ref|ZP_05989808.1| DNA-directed DNA polymerase III beta subunit [Mannheimia
           haemolytica serotype A2 str. BOVINE]
 gi|261496475|ref|ZP_05992855.1| DNA-directed DNA polymerase III beta subunit [Mannheimia
           haemolytica serotype A2 str. OVINE]
 gi|261307678|gb|EEY09001.1| DNA-directed DNA polymerase III beta subunit [Mannheimia
           haemolytica serotype A2 str. OVINE]
 gi|261311131|gb|EEY12307.1| DNA-directed DNA polymerase III beta subunit [Mannheimia
           haemolytica serotype A2 str. BOVINE]
          Length = 369

 Score =  207 bits (526), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 127/388 (32%), Positives = 217/388 (55%), Gaps = 24/388 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEIT--GAIP 58
           M+IT+ R  +L+ L   C ++  + T+PV  ++LL+     L +  +  E+E+T    + 
Sbjct: 3   MQITITREQLLKPLQQVCGVLSSRPTLPVINNLLLEIEGNRLSLTGTDLEVELTTQAQLL 62

Query: 59  ASVDVCGSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESE 117
            +VD  G  T+ A    DI + L D + IS  F+E++      I  G S F L + P S+
Sbjct: 63  QAVDFAGKFTIPAKKFLDISKSLPDDSVISVQFEEDK----AIIKAGRSKFSLATLPASD 118

Query: 118 FPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATD 177
           +P+  + +    F +  S L  L++ T F+MA ++ RY+LNG+ F      L+   VATD
Sbjct: 119 YPNLMDWKPEVDFSIDQSTLARLIDATQFSMANQDARYFLNGMKFETEGNLLR--TVATD 176

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLAV  + ++ Q     S+IVPRKAV E+ R+++S D +V++ +  S I + +  +  
Sbjct: 177 GHRLAVCTM-VLNQELLTHSVIVPRKAVLELSRLVASNDETVRLEIGSSNIRITMNGIVF 235

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +LIDG FP+Y+ V+P + D+ L      L++A+ R +I+S+ + + V+L+LS++ L +
Sbjct: 236 TSKLIDGRFPDYRRVLPRNADRILEAETETLKRALMRAAILSNEKFRGVRLTLSNNLLKI 295

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           T +NP+  +A E ++V Y+   M++ FN  Y+L++++ +         V F L  S+SS 
Sbjct: 296 TANNPEQEEAEEIIDVAYDSPEMEVGFNVSYVLDVLNTLKC-----QRVRFSLVDSSSSC 350

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            I   D  S         A YV+MPMR+
Sbjct: 351 LIEDCDNSS---------AEYVIMPMRL 369


>gi|225630799|ref|YP_002727590.1| DNA polymerase III, beta subunit [Wolbachia sp. wRi]
 gi|225592780|gb|ACN95799.1| DNA polymerase III, beta subunit [Wolbachia sp. wRi]
          Length = 385

 Score =  207 bits (526), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 129/384 (33%), Positives = 218/384 (56%), Gaps = 20/384 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ +V R+ +L  L     ++ER+N+I V   + ++A  G +++ A+  +I +  ++ A+
Sbjct: 21  MRFSVSRTSLLNTLSRVSGVVERRNSIDVLACINIKAQHGSIKLMATDLDISMFASLAAT 80

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V   G + +SAH L+DIV+KL     ++F   N+   ++ +S G++NF L +   S FP+
Sbjct: 81  VLTEGEVKISAHTLHDIVKKLPADLDVNFEVNNQ--GKLLMSCGNANFSLPNVVSSSFPA 138

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
            +E+ Y + F L ++ L +L+ +T FA++ ++ RY LNGI+ H +E+   L  VATDGHR
Sbjct: 139 LEEDNYKHDFILLNTDLIDLLTKTKFAVSLDDTRYNLNGIYLHTDEQ--FLYCVATDGHR 196

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           L+  +      I     +I+PRK V E+L+IL   +  +KV LS+ +I L      +  +
Sbjct: 197 LSCIKRPKPGNINGEFGVIIPRKTVMELLKILDDCNE-IKVKLSDRKIKLTCGEYILISK 255

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDG FPNY+ VIP S DK + +    L   +DRVS++ S +++++K SL    L +  +
Sbjct: 256 LIDGTFPNYKAVIPASQDKHMIIESKKLSDVIDRVSVVVSDKVKSIKFSLQEKLLTLHSN 315

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           + +   A ES+ V YNE P++I FN +YLL+++        + ++  F L   NS+  I 
Sbjct: 316 SQECSDATESIEVDYNEAPIEIGFNSRYLLDVL------SCIKNKCKFSLADGNSATIIT 369

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMR 384
            +D  S           YV+MPMR
Sbjct: 370 DEDDSS---------VLYVVMPMR 384


>gi|56417078|ref|YP_154152.1| DNA polymerase III beta chain [Anaplasma marginale str. St. Maries]
 gi|222475444|ref|YP_002563861.1| DNA polymerase III beta chain (dnaN) [Anaplasma marginale str.
           Florida]
 gi|255003430|ref|ZP_05278394.1| DNA polymerase III beta chain (dnaN) [Anaplasma marginale str.
           Puerto Rico]
 gi|255004549|ref|ZP_05279350.1| DNA polymerase III beta chain (dnaN) [Anaplasma marginale str.
           Virginia]
 gi|56388310|gb|AAV86897.1| DNA polymerase III beta chain [Anaplasma marginale str. St. Maries]
 gi|222419582|gb|ACM49605.1| DNA polymerase III beta chain (dnaN) [Anaplasma marginale str.
           Florida]
          Length = 379

 Score =  206 bits (525), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 128/389 (32%), Positives = 218/389 (56%), Gaps = 25/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           ++ ++ R D+L+ L +   +IER+N+I V   V ++A DG++E+ ++  +I I   + AS
Sbjct: 12  LECSISREDLLQSLAYVSSVIERRNSIAVLSCVRVEAKDGVVELSSTDLDISIEACVNAS 71

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESEFP 119
           V   G +  SA LLYDIVRKL     + F   +  L  E     G++ F+L      +FP
Sbjct: 72  VVHKGVVVASAQLLYDIVRKLSGDCAVGFKMSDGRLLVEC----GNAKFFLHVVAPEKFP 127

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + +  E    F++  S +  L+ +T F+M+ EE RY L G++ H+ E+   LC VATDGH
Sbjct: 128 AIEGGEVDCGFDMQVSHIAELLNKTKFSMSVEESRYNLRGVYMHVAED--MLCCVATDGH 185

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSK-DSS--VKVSLSESRIHLNIESLS 236
           RL++A+V+    +     +IVPRK V E+L+I+    D+S  V VS+S+ +I    +   
Sbjct: 186 RLSLAKVNRPEGLQPDIGVIVPRKTVNELLKIIGGGGDASQVVSVSISQRKICFRYKGYF 245

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
           M  +++DG FP+Y ++IP      + ++  +L  AVDRVS++   +++A+KLS +S +L 
Sbjct: 246 MVSKVVDGVFPDYLSIIPQERGASVSMDACSLLSAVDRVSVVVFDKVKAIKLSFASGRLT 305

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           ++  + D G A E + V Y    + I  N +YL+E++  +        EVVF+    N++
Sbjct: 306 LSSASSDQGDAREELEVDYKGDEVTIGLNARYLIEVLGCMKG----ACEVVFQ--DGNTA 359

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           V I+ K+            + +++MPMRI
Sbjct: 360 VLIQDKEPG---------GSMHIIMPMRI 379


>gi|269958514|ref|YP_003328301.1| DNA polymerase III, beta subunit [Anaplasma centrale str. Israel]
 gi|269848343|gb|ACZ48987.1| DNA polymerase III, beta subunit [Anaplasma centrale str. Israel]
          Length = 379

 Score =  206 bits (524), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 128/389 (32%), Positives = 218/389 (56%), Gaps = 25/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           ++ ++ R D+L+ L +   +IER+N+I V   V ++A DG++E+ ++  +I I   + AS
Sbjct: 12  LECSISREDLLQSLAYVSSVIERRNSIAVLSCVRVEAKDGVVELSSTDLDISIEACVNAS 71

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESEFP 119
           V   G +  SA LLYDIVRKL     + F   +  L  E     G++ F+L      +FP
Sbjct: 72  VVHKGVVVASAQLLYDIVRKLSGDCAVGFKMSDGRLLVEC----GNAKFFLHVVAPEKFP 127

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + +  E    F++  S +  L+ +T F+M+ EE RY L G++ H+ E+   LC VATDGH
Sbjct: 128 AIEGGEVDCGFDMQVSHIAELLNKTKFSMSVEESRYNLRGVYMHVAED--MLCCVATDGH 185

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSK-DSS--VKVSLSESRIHLNIESLS 236
           RL++A+V+    +     +IVPRK V E+L+I+    D+S  V VS+S+ +I    +   
Sbjct: 186 RLSLAKVNRPEGLQPDIGVIVPRKTVNELLKIIGGGGDASQVVSVSISQRKICFRYKGYF 245

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
           M  +++DG FP+Y ++IP      + ++  +L  AVDRVS++   +++A+KLS +S +L 
Sbjct: 246 MVSKVVDGVFPDYLSIIPQERGASVSMDACSLLSAVDRVSVVVFDKVKAIKLSFASGRLT 305

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           ++  + D G A E + V Y    + I  N +YL+E++  +        EVVF+    N++
Sbjct: 306 LSSASSDQGDAREELEVDYKGDEVTIGLNARYLIEVLGCMKG----ACEVVFQ--DGNTA 359

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           V I+ K+            + +++MPMRI
Sbjct: 360 VLIQDKEPG---------GSMHIIMPMRI 379


>gi|330447268|ref|ZP_08310918.1| DNA polymerase III, beta subunit [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491459|dbj|GAA05415.1| DNA polymerase III, beta subunit [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 366

 Score =  206 bits (524), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 116/386 (30%), Positives = 215/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK TVER  +L+ L      +  + ++P+  ++LL+  DG L +  +  E+E+   +   
Sbjct: 1   MKFTVEREHLLKPLQQVAAALGGRPSLPILGNILLKVEDGCLSMTGTDLEVELIAKVALD 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   G++TV +    DI R L   A IS   E   G  V I  G S + L + P ++FP
Sbjct: 61  GEFESGAVTVPSRKFLDICRGLPSSASISVSYE---GDRVLIRSGRSRYTLTTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +    F L    ++ L++ T F+MA +++RYYLNG+ F  + + L+  +VATDGH
Sbjct: 118 NIEDWQSEVEFTLEQGRMRQLIDSTQFSMANQDVRYYLNGMLFETDGQHLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AV  ++   ++     IIVPRK V E++R+  + ++ V + +  S I   + +   + 
Sbjct: 176 RMAVCAINTGHELPT-KQIIVPRKGVLELVRLFDNPEAEVNIQIGNSNIRATVNNFVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P ++ K +   C  +R A  R +I+S+ + + V+++LS+ ++ +T 
Sbjct: 235 KLVDGRFPDYRRVMPQNSTKFVEAGCEEMRNAFARAAILSNEKFRGVRVNLSNGEIRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    ++I FN  Y+L++++ +       D+V   L  +N+   I
Sbjct: 295 NNPEQEEAEEFLDVDYQGDSLEIGFNVSYVLDVLNTLKC-----DQVRLSLSDANAPSLI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
               +DS N++     A YV+MP+R+
Sbjct: 350 ----EDSNNDE-----AMYVVMPIRL 366


>gi|332991510|gb|AEF01565.1| DNA polymerase III subunit beta [Alteromonas sp. SN2]
          Length = 366

 Score =  206 bits (524), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 119/386 (30%), Positives = 214/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK ++ R   L+ L      +ER++T+P+  +VL++ ++  L +  +  E+E+  ++   
Sbjct: 1   MKFSISREQFLQPLQLVSGAVERRHTLPILSNVLIKVSEDALWLTGTDLEVELISSVKLE 60

Query: 61  VDVC-GSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   G ITV A  L+DI+R + +G  I F  +   G +  I  G   + L +   +++P
Sbjct: 61  GEFTEGEITVPAKKLFDIIRGISEGTDIHFSID---GNKALIKAGRGRYTLSTLSANDYP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ E    FE+  S +K L++ T F+MA +++RYYLNG+     E  ++   VATDGH
Sbjct: 118 NLEDWEGEVEFEITCSDMKRLIDSTSFSMAQQDVRYYLNGMSLETEENIIR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA+  +     +     +I+PRK V EI R+++  D S+KV +  + + +       + 
Sbjct: 176 RLALCRLSYETTLPAR-QVIIPRKGVLEISRLITEDDKSLKVQIGANHLRIFSNDFIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P   DKE+  +   L+ A  R +I+S+ + + V+L+LSS +L +T 
Sbjct: 235 KLVDGRFPDYRRVLPQDGDKEIIASKAVLKDAFSRAAILSNEKFRGVRLNLSSGELKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    ++I FN  YL+++++++ S     D+V   L  SN+S  I
Sbjct: 295 NNPEQEEAEEIVDVNYQGDDLEIGFNVAYLIDVLNSLGS-----DDVKISLSDSNASALI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
                D+         A YV+MPMR+
Sbjct: 350 EDAADDA---------ALYVIMPMRL 366


>gi|312958104|ref|ZP_07772627.1| DNA polymerase III beta subunit [Pseudomonas fluorescens WH6]
 gi|311287535|gb|EFQ66093.1| DNA polymerase III beta subunit [Pseudomonas fluorescens WH6]
          Length = 367

 Score =  206 bits (523), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 124/389 (31%), Positives = 214/389 (55%), Gaps = 26/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAI--- 57
           M  T++R  +L+ L     ++ER+ T+PV  +VLL      L +  +  E+E+ G +   
Sbjct: 1   MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLTGTDLEVELVGRVQLE 60

Query: 58  -PASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPES 116
            PA     G ITV A  L DI + L + A I    + +   ++ +  G S F L + P +
Sbjct: 61  EPAE---PGEITVPARKLMDICKSLPNDALIDIKVDEQ---KLVVKAGRSRFTLSTLPAN 114

Query: 117 EFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVAT 176
           +FP+ +E     +  L  S L+ L+ERT FAMA +++RYYLNG+   ++E  ++  AVAT
Sbjct: 115 DFPTVEEGPGSLTCSLEQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVSEGIIR--AVAT 172

Query: 177 DGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLS 236
           DGHRLA+  +           +IVPRK + E+ R+L+  D +V + L +  I       +
Sbjct: 173 DGHRLAMCSMRADIGQPDRHQVIVPRKGILELARLLTEPDGNVSIVLGQHHIRATTGEFT 232

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
            + +L+DG+FP+Y+ V+P   DK +  +   LR+A  R +I+S+ + + ++L L++ +L 
Sbjct: 233 FTSKLVDGKFPDYERVLPKGGDKLVLGDRQALREAFSRTAILSNEKYRGIRLQLANGQLK 292

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           +  +NP+  +A E ++V YN   ++I FN  YLL+++  +++     ++V   L  SNSS
Sbjct: 293 IQANNPEQEEAEEEISVDYNGGSLEIGFNVSYLLDVLGVMTT-----EQVRLILSDSNSS 347

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             ++  D D         ++ YV+MPMR+
Sbjct: 348 ALVQESDND---------DSAYVVMPMRL 367


>gi|90581123|ref|ZP_01236922.1| DNA polymerase III subunit beta [Vibrio angustum S14]
 gi|90437644|gb|EAS62836.1| DNA polymerase III subunit beta [Vibrio angustum S14]
          Length = 366

 Score =  205 bits (522), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 117/386 (30%), Positives = 214/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK TVER  +L+ L      +  + ++P+  ++LL+  DG L +  +  E+E+   +   
Sbjct: 1   MKFTVEREYLLKPLQQVAAALGGRPSLPILGNILLKVEDGCLSMTGTDLEVELIAKVALE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D   G++TV +    DI R L   A IS   E   G  V I    S + L + P ++FP
Sbjct: 61  GDYESGTVTVPSRKFLDICRGLPSNATISVSYE---GDRVLIRSSRSRYTLTTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +    F L    ++ L++ T F+MA +++RYYLNG+ F  + + L+  +VATDGH
Sbjct: 118 NIEDWQSEVEFTLEQGRMRQLIDSTQFSMANQDVRYYLNGMLFETDGQHLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AV  +D   ++     IIVPRK V E++R+  + +S V + +  S I   + +   + 
Sbjct: 176 RMAVCAIDTGHELPT-KQIIVPRKGVLELVRLFDNPESLVNIQIGNSNIRATVNNFVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P ++ K +   C  +R A  R +I+S+ + + V+++LS+ ++ +T 
Sbjct: 235 KLVDGRFPDYRRVMPQNSTKFVEAGCEEMRNAFARAAILSNEKFRGVRVNLSNGEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    ++I FN  Y+L++++ +       D+V   L  +N+   I
Sbjct: 295 NNPEQEEAEEFLDVDYQGDSLEIGFNVSYVLDVLNTLKC-----DQVRLSLSDANAPSLI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
               +D+ N++     A YV+MP+R+
Sbjct: 350 ----EDATNDE-----AMYVVMPIRL 366


>gi|104779318|ref|YP_605816.1| DNA polymerase III subunit beta [Pseudomonas entomophila L48]
 gi|95108305|emb|CAK12999.1| DNA polymerase III, beta chain [Pseudomonas entomophila L48]
          Length = 367

 Score =  205 bits (522), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 123/389 (31%), Positives = 213/389 (54%), Gaps = 26/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAI--- 57
           M  T++R  +L+ L     ++ER+ T+PV  +VLL      L +  +  E+E+ G +   
Sbjct: 1   MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVQGQQLSLTGTDLEVELVGRVQLE 60

Query: 58  -PASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPES 116
            PA     G ITV A  L DI + L   A I    + +   ++ +  G S F L + P +
Sbjct: 61  EPAE---PGEITVPARKLMDICKSLPSDALIDIKVDEQ---KLLVKAGRSRFTLSTLPAN 114

Query: 117 EFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVAT 176
           +FP+ +E     + +L  S L+ L+ERT FAMA +++RYYLNG+   ++   L+  AVAT
Sbjct: 115 DFPTVEEGPGSLTCQLEQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVSPGTLR--AVAT 172

Query: 177 DGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLS 236
           DGHRLA+  +      A    +IVPRK + E+ R+L+  + +V + L +  I       +
Sbjct: 173 DGHRLALCAMQAPIDQADRHQVIVPRKGILELARLLTDPEGTVSIVLGQHHIRATTGEFT 232

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
            + +L+DG+FP+Y+ V+P   DK +  +   LR+A  R +I+S+ + + ++L L++ +L 
Sbjct: 233 FTSKLVDGKFPDYERVLPKGGDKLVIGDRQALREAFSRTAILSNEKYRGIRLQLAAGQLK 292

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           +  +NP+  +A E ++V YN   ++I FN  YLL+++  +++     ++V   L  SNSS
Sbjct: 293 IQANNPEQEEAEEEISVDYNGSSLEIGFNVSYLLDVLGVMTT-----EQVRLILSDSNSS 347

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             ++    D         ++ YV+MPMR+
Sbjct: 348 ALLQEAGND---------DSSYVVMPMRL 367


>gi|89074701|ref|ZP_01161159.1| DNA polymerase III subunit beta [Photobacterium sp. SKA34]
 gi|89049465|gb|EAR55026.1| DNA polymerase III subunit beta [Photobacterium sp. SKA34]
          Length = 366

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 116/386 (30%), Positives = 215/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK TVER  +L+ L      +  + ++P+  ++LL+  DG L +  +  E+E+   +   
Sbjct: 1   MKFTVEREYLLKPLQQVAAALGGRPSLPILGNILLKVEDGCLSMTGTDLEVELIAKVVLE 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            D   G++TV +    DI R L   A IS   E   G  V I    S + L + P ++FP
Sbjct: 61  GDYESGTVTVPSRKFLDICRGLPSNATISVSYE---GDRVLIRSSRSRYTLTTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++ +   +F L    ++ L++ T F+MA +++RYYLNG+ F  + + L+  +VATDGH
Sbjct: 118 NIEDWQSEVAFTLEQGRMRQLIDSTQFSMANQDVRYYLNGMLFETDGQHLR--SVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           R+AV  +D   ++     +IVPRK V E++R+  + +S V + +  S I   + +   + 
Sbjct: 176 RMAVCAIDTGHELPT-KQVIVPRKGVLELVRLFDNPESLVNIQIGNSNIRATVNNFVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P ++ K +   C  +R A  R +I+S+ + + V+++LS+ ++ +T 
Sbjct: 235 KLVDGRFPDYRRVMPQNSTKFVEAGCEEMRNAFARAAILSNEKFRGVRVNLSNGEMRITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V Y    ++I FN  Y+L++++ +       D+V   L  +N+   I
Sbjct: 295 NNPEQEEAEEFLDVDYQGDSLEIGFNVSYVLDVLNTLKC-----DQVRLSLSDANAPSLI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
               +D+ N++     A YV+MP+R+
Sbjct: 350 ----EDATNDE-----AMYVVMPIRL 366


>gi|146280399|ref|YP_001170552.1| DNA polymerase III subunit beta [Pseudomonas stutzeri A1501]
 gi|145568604|gb|ABP77710.1| DNA polymerase III, beta subunit [Pseudomonas stutzeri A1501]
 gi|327478614|gb|AEA81924.1| DNA polymerase III subunit beta [Pseudomonas stutzeri DSM 4166]
          Length = 367

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 126/387 (32%), Positives = 214/387 (55%), Gaps = 22/387 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M  +++R  +L+ L     ++ER+ T+PV  +VLL      L +  +  E+E+ G + A 
Sbjct: 1   MHFSIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVQGQQLSLTGTDLEVELVGRV-AL 59

Query: 61  VDVC--GSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEF 118
            D    G ITV A  L DI + L   A IS   +++   +V I  G S F L + P ++F
Sbjct: 60  EDAAEPGEITVPARKLMDICKSLPSDALISIRLDDQ---KVVIKSGRSRFTLSTLPANDF 116

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P+ +E     SF +A   L+ L+ER+ FAMA +++RYYLNG+   ++   L+  AVATDG
Sbjct: 117 PTVEEGPGSLSFTVAQGKLRKLIERSAFAMAQQDVRYYLNGMLIEVSSGMLR--AVATDG 174

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA+  +    +      +IVPRK + E+ R+L+ +D+ V + L +  I       + +
Sbjct: 175 HRLAMCSMQAGIEQPDRHQVIVPRKGILELARLLNDQDAEVSIVLGQHHIRATTGEFTFT 234

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +L+DG+FP+Y+ V+P   DK +  +   LR+A  R +I+S+ + + ++L L S  L + 
Sbjct: 235 SKLVDGKFPDYERVLPRGGDKLVVGDRQLLREAFSRTAILSNEKYRGIRLQLESGLLKIQ 294

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
            +NP+  +A E + V YN   ++I FN  YLL+++  +++     ++V   L  +NSS  
Sbjct: 295 ANNPEQEEAEEEVAVDYNGGSLEIGFNVSYLLDVLGVMTT-----EQVRLILSDANSSAL 349

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           ++  D D         ++ YV+MPMR+
Sbjct: 350 VQEFDND---------DSAYVVMPMRL 367


>gi|149925375|ref|ZP_01913639.1| DNA polymerase III subunit beta [Limnobacter sp. MED105]
 gi|149825492|gb|EDM84700.1| DNA polymerase III subunit beta [Limnobacter sp. MED105]
          Length = 368

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 124/370 (33%), Positives = 206/370 (55%), Gaps = 26/370 (7%)

Query: 20  IIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPASVDVCG---SITVSAHLLYD 76
           I+ER+NT+PV  ++LL+   GLL + +S  E++I  +  A V   G   + TV+A    D
Sbjct: 21  IVERRNTLPVLANILLKKQGGLLTLLSSDIEMQIETS--AEVGAGGEDTATTVAARKFLD 78

Query: 77  IVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPSTKE-EEYVYSFELASS 135
           I+R L + + +    +   G ++++    S F LQ+ P  +FP  +E +E+V    L   
Sbjct: 79  ILRSLPEDSDVMVKLD---GKKMSVQAKKSRFALQTLPAEDFPLVQEPKEWVTQISLPQK 135

Query: 136 VLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAVAEVDIVAQIAKM 195
           +LKNL+   HF+MA +++RYYLNG+   I  E   + AVATDGHRLA A+       AK 
Sbjct: 136 MLKNLLGMVHFSMAQQDLRYYLNGVLLVI--ESACVRAVATDGHRLAYADAPGQGGTAKH 193

Query: 196 PSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLIDGEFPNYQNVIPC 255
             +I+PRK V E+ R+L+  D +V + L+ ++       +++  +L++G+FP+YQ VIP 
Sbjct: 194 -EVIIPRKTVLELSRLLNDTDDTVTIDLASNQAKFTFSDITLITKLVEGKFPDYQRVIPK 252

Query: 256 SNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPDMGKAIESMNVYY 315
           ++   + +    L  ++ R SI++S + + ++  L ++ L +  +N D  +A + M V Y
Sbjct: 253 THQHHVVIARDALLHSLQRASILTSDKFRGIRWVLGANGLTIVANNSDQEEARDEMEVEY 312

Query: 316 NECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIRGKDKDSKNNKDNKVN 375
               +D+ FN  YLL++++N+ S     + V F L   NSS  +    KD     D K  
Sbjct: 313 QGPEIDVGFNVNYLLDVLNNLKS-----ETVQFTLQDGNSSALVTTPGKD-----DFK-- 360

Query: 376 AFYVLMPMRI 385
             YV+MPMRI
Sbjct: 361 --YVVMPMRI 368


>gi|15836607|ref|NP_297295.1| DNA polymerase III subunit beta [Xylella fastidiosa 9a5c]
 gi|9104762|gb|AAF82815.1|AE003855_2 DNA polymerase III, beta chain [Xylella fastidiosa 9a5c]
          Length = 366

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 121/385 (31%), Positives = 209/385 (54%), Gaps = 19/385 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+  ++R   L+ L H   ++ER+ T  +  ++L++ N+  L +  +  E+E+       
Sbjct: 1   MRFRLQRETFLKPLAHVVNVVERRQTRSILANLLIKVNEDQLSLTGTDLEVEMISKTIIE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               G IT+ A  +Y+IVR L D +Q+S ++ ++   ++ +  G S F L + P ++FPS
Sbjct: 61  DAESGEITIPARKIYEIVRALPDSSQLSVYQSDD---KITLQAGRSRFTLATLPANDFPS 117

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
             + E      +   +LK L+ERT FAMA +++RYYLNG+ F +   D KL  VATDGHR
Sbjct: 118 IDKIEVTERIIIPEVLLKELIERTAFAMAQQDVRYYLNGLLFDLR--DTKLRCVATDGHR 175

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LA+ E ++         II+PRK V E+ R+L   D  +++ ++ + I +    ++ + +
Sbjct: 176 LALCETELEQAKDLKRQIILPRKGVMELQRLLEGSDRQIELEIARNHIRMKSFDVTFTSK 235

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDG FP+Y+ VIP   D+E++V    LR A+ R +I+S+ + + V++ +S  +L +   
Sbjct: 236 LIDGSFPDYEGVIPIGADREVKVAREVLRDALQRAAILSNEKYRGVRIEVSPGQLKINAH 295

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           NP+  +A E +        + I FN  YLL+ + ++       D V  +L  SNSS  IR
Sbjct: 296 NPEQEEAQEEIEAQTIVDGLAIGFNVNYLLDALSSLRG-----DFVNIQLRDSNSSALIR 350

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
                    + N   +  V+MP+R+
Sbjct: 351 ---------ESNSEKSLQVVMPLRL 366


>gi|255320701|ref|ZP_05361878.1| DNA polymerase III, beta subunit [Acinetobacter radioresistens
           SK82]
 gi|262380668|ref|ZP_06073821.1| DNA polymerase III, beta subunit [Acinetobacter radioresistens
           SH164]
 gi|255302317|gb|EET81557.1| DNA polymerase III, beta subunit [Acinetobacter radioresistens
           SK82]
 gi|262297616|gb|EEY85532.1| DNA polymerase III, beta subunit [Acinetobacter radioresistens
           SH164]
          Length = 382

 Score =  204 bits (519), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 123/402 (30%), Positives = 215/402 (53%), Gaps = 37/402 (9%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++ + +  +L +L H    +ER++T+ +  +V +QA+   L I  S  E+E+  +   S
Sbjct: 1   MRLKIAKESLLNVLSHVVGAVERRHTLNILSNVKIQASPQALTITGSDLEVELVASTGLS 60

Query: 61  VDVC---GSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPES 116
              C   G  TV A  L DI + L   A I     E++      +  G+S F L + P  
Sbjct: 61  EGACLQPGETTVPARKLMDICKSLPSAALIDLQITEDQ---RCILKSGNSRFVLGTLPAE 117

Query: 117 EFPS-TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVA 175
           ++P    +       ++    LK L E+T FAMA +++R+YL G    I+E  L+  AV 
Sbjct: 118 DYPLLNHDNSQGTQVQVTQRELKRLFEKTAFAMAVQDVRFYLTGTLLEIDETQLR--AVT 175

Query: 176 TDGHRLAVAEVDIVAQIAKMP-SIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIES 234
           TDGHRLA+ E  + +  A  P   IVPRKAV E+ R+LS +D  + + +    +++ I++
Sbjct: 176 TDGHRLALCET-LASSTASQPVQAIVPRKAVAELQRLLSIEDEQLTLLIGRELLNVTIQT 234

Query: 235 LS-----------MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRI 283
            S            + +LIDG+FP+Y+ VIP   DK +++     +Q++ RV+I+S+ ++
Sbjct: 235 PSRDKEQGEITVRFTTKLIDGKFPDYRRVIPRGGDKTVQIAHDVFKQSLQRVAILSNEKL 294

Query: 284 QAVKLSLSSDKLCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVD 343
           + V L+ ++D L +  +NP+  +AIE + + YN  P+++ FN +YLLE+++ +       
Sbjct: 295 RGVFLNFNADSLQLRANNPEQDEAIEDLAIQYNNSPLEMSFNAQYLLEVLNVLDG----- 349

Query: 344 DEVVFRLDSSNSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           D+VV  +  +N SV ++   +  +          YV+MPMR+
Sbjct: 350 DDVVMTMTEANQSVLVQDPAQQDQT---------YVVMPMRV 382


>gi|262371172|ref|ZP_06064493.1| DNA polymerase subunit III [Acinetobacter johnsonii SH046]
 gi|262313902|gb|EEY94948.1| DNA polymerase subunit III [Acinetobacter johnsonii SH046]
          Length = 382

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 121/401 (30%), Positives = 207/401 (51%), Gaps = 35/401 (8%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++ + +  +L +L H    +ER++T+ +  +V +Q     L I  S  E+E+  + P +
Sbjct: 1   MRLKIAKESLLNVLSHVVGAVERRHTLNILSNVKVQVTQASLTITGSDLEVELVASTPLT 60

Query: 61  VDVC---GSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPES 116
              C   G  TV A  L DI + L   A I     E++      +  G+S F L + P  
Sbjct: 61  EGACLQAGETTVPARKLMDICKSLPTAALIDLQITEDQ---RCILKSGNSRFVLGTLPAE 117

Query: 117 EFPS-TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVA 175
           ++P  T E        +    LK L E+T FAMA +++R+YL G    I+   L+  AV 
Sbjct: 118 DYPLLTTENTQGTQVAVTQRELKRLFEKTAFAMAVQDVRFYLTGTLLEIDNNQLR--AVT 175

Query: 176 TDGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESL 235
           TDGHRLA+ E    +   ++   IVPRKAVGE+ R+LS +D  + + +    +++ I   
Sbjct: 176 TDGHRLALCETVASSNATQLIQAIVPRKAVGELQRLLSIEDEQLALLIGRELLNVTISIA 235

Query: 236 S-----------MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQ 284
           S            + +LIDG+FP+Y+ VIP   DK + +     +Q++ RVSI+S+ +++
Sbjct: 236 SRDKEQGDTMVRFTTKLIDGKFPDYRRVIPRGGDKNVLIAHDVFKQSLQRVSILSNEKLR 295

Query: 285 AVKLSLSSDKLCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDD 344
            V L+ ++D L +  +NP+  +A+E + + YN  PM++ FN +Y+LE++  +       D
Sbjct: 296 GVFLNFAADTLQLRANNPEQDEAVEDLAIQYNNAPMEMSFNAQYILEVLGALDG-----D 350

Query: 345 EVVFRLDSSNSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +V   +  +N SV ++      +          YV+MPMR+
Sbjct: 351 DVSMTMTEANQSVLVQDPAHQDQT---------YVVMPMRV 382


>gi|229587580|ref|YP_002869699.1| DNA polymerase III subunit beta [Pseudomonas fluorescens SBW25]
 gi|229359446|emb|CAY46287.1| DNA polymerase III, beta chain [Pseudomonas fluorescens SBW25]
          Length = 367

 Score =  204 bits (518), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 125/389 (32%), Positives = 214/389 (55%), Gaps = 26/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAI--- 57
           M  T++R  +L+ L     ++ER+ T+PV  +VLL      L +  +  E+E+ G +   
Sbjct: 1   MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLTGTDLEVELVGRVQLE 60

Query: 58  -PASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPES 116
            PA     G ITV A  L DI + L + A I   K +E   ++ +  G S F L + P +
Sbjct: 61  EPAE---PGEITVPARKLMDICKSLPNDALIDI-KVDE--AKLVVKAGRSRFTLSTLPAN 114

Query: 117 EFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVAT 176
           +FP+ +E     +  L  S L+ L+ERT FAMA +++RYYLNG+   ++E  ++  AVAT
Sbjct: 115 DFPTVEEGPGSLTCSLEQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVSEGIIR--AVAT 172

Query: 177 DGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLS 236
           DGHRLA+  +           +IVPRK + E+ R+L+  + +V + L +  I       +
Sbjct: 173 DGHRLAMCSMRADIGQPDRHQVIVPRKGILELARLLTEPEGNVSIVLGQHHIRATTGEFT 232

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
            + +L+DG+FP+Y+ V+P   DK +  +   LR+A  R +I+S+ + + ++L L++ +L 
Sbjct: 233 FTSKLVDGKFPDYERVLPKGGDKLVLGDRQALREAFSRTAILSNEKYRGIRLQLANGQLK 292

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           +  +NP+  +A E + V YN   ++I FN  YLL+++  +++     ++V   L  SNSS
Sbjct: 293 IQANNPEQEEAEEEVGVDYNGGSLEIGFNVSYLLDVLGVMTT-----EQVRLILSDSNSS 347

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             ++  D D         ++ YV+MPMR+
Sbjct: 348 ALVQESDND---------DSAYVVMPMRL 367


>gi|330806659|ref|YP_004351121.1| DNA polymerase III subunit beta [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327374767|gb|AEA66117.1| DNA polymerase III subunit beta [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 367

 Score =  203 bits (517), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 124/389 (31%), Positives = 213/389 (54%), Gaps = 26/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAI--- 57
           M  T++R  +L+ L     ++ER+ T+PV  +VLL      L +  +  E+E+ G +   
Sbjct: 1   MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLTGTDLEVELVGRVQLE 60

Query: 58  -PASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPES 116
            PA     GSITV A  L DI + L + A I    + +   ++ +  G S F L + P +
Sbjct: 61  EPAD---PGSITVPARKLMDICKSLPNDALIDIKVDEQ---KLVVKAGRSRFTLSTLPAN 114

Query: 117 EFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVAT 176
           +FP+ +E     +  L  S L+ L+ERT FAMA +++RYYLNG+   ++   ++  AVAT
Sbjct: 115 DFPTVEEGPGSLTCSLDQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVSAGVIR--AVAT 172

Query: 177 DGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLS 236
           DGHRLA+  +           +IVPRK + E+ R+L+  D +V + L +  I       +
Sbjct: 173 DGHRLAMCSMQADIGQPDRHQVIVPRKGILELARLLTEPDGNVSIVLGQHHIRATTGEFT 232

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
            + +L+DG+FP+Y+ V+P   DK +  +   LR+A  R +I+S+ + + ++L L++ +L 
Sbjct: 233 FTSKLVDGKFPDYERVLPKGGDKLVLGDRQALREAFSRTAILSNEKYRGIRLQLANGQLK 292

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           +  +NP+  +A E + V YN   ++I FN  YLL+++  +++     ++V   L  SNSS
Sbjct: 293 IQANNPEQEEAEEEVGVEYNGGSLEIGFNVSYLLDVLGVMTT-----EQVRLILSDSNSS 347

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             ++  D D         ++ YV+MPMR+
Sbjct: 348 ALVQESDND---------DSAYVVMPMRL 367


>gi|118496617|ref|YP_897667.1| DNA polymerase III, beta subunit [Francisella tularensis subsp.
           novicida U112]
 gi|194323923|ref|ZP_03057698.1| DNA polymerase III, beta subunit [Francisella tularensis subsp.
           novicida FTE]
 gi|254372004|ref|ZP_04987497.1| hypothetical protein FTCG_01143 [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|254375146|ref|ZP_04990626.1| DNA polymerase III [Francisella novicida GA99-3548]
 gi|118422523|gb|ABK88913.1| DNA polymerase III, beta subunit [Francisella novicida U112]
 gi|151569735|gb|EDN35389.1| hypothetical protein FTCG_01143 [Francisella novicida GA99-3549]
 gi|151572864|gb|EDN38518.1| DNA polymerase III [Francisella novicida GA99-3548]
 gi|194321820|gb|EDX19303.1| DNA polymerase III, beta subunit [Francisella tularensis subsp.
           novicida FTE]
 gi|328676080|gb|AEB26950.1| DNA polymerase III beta subunit [Francisella cf. novicida Fx1]
          Length = 367

 Score =  203 bits (517), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 126/389 (32%), Positives = 223/389 (57%), Gaps = 26/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M   + R D+L+ L     +   K+T+P+   +L   ++  L+I AS  + EI+  I  S
Sbjct: 1   MNFVLNRDDLLKPLQSMLSVANSKSTMPLLSCILFDIDNNNLKITASDLDTEISCNIAVS 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP- 119
            +    + ++A  +Y+IVR L + + I F + NE   +V I   +S F L S     +P 
Sbjct: 61  CNTTIKLALNADKIYNIVRSLNENSMIDF-RVNE--NKVTIVSNNSTFNLISLNADNYPL 117

Query: 120 --STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATD 177
             S   E+   SF+L+     +++ +  F+MA ++ RY+LNG+F+ IN   L+  AV+TD
Sbjct: 118 IDSNINEQA--SFDLSQQDFHHIISKVDFSMANDDTRYFLNGMFWEINANLLR--AVSTD 173

Query: 178 GHRLAVAEVDIVAQIAKMPS-IIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLS 236
           GHR+++ E  I +++    S  I+P+KA+ E+ +I+   + ++K+ L ++ +     + +
Sbjct: 174 GHRMSITEAIIDSKVLDSASQSIIPKKAILELKKIVGKTEENIKICLGKNYLKAIFGNYA 233

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
              +LIDG +P+YQ VIP +N K L V+    + ++ R SI+++ + + V+L++S ++L 
Sbjct: 234 FISKLIDGRYPDYQKVIPKNNTKLLAVDKQFFKNSLLRTSILANDKYKGVRLNISQNQLL 293

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           ++ +NPD  KA + + V YN+ PM+ICFNYKYLL+II N+ S+E +       LD+ N S
Sbjct: 294 LSANNPDNEKAEDKIEVQYNDQPMEICFNYKYLLDII-NVLSEETMS----IYLDNPNMS 348

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +          KD K N+ +++MPM+I
Sbjct: 349 ALV----------KDEKDNSLFIIMPMKI 367


>gi|262281563|ref|ZP_06059342.1| DNA polymerase subunit III [Acinetobacter calcoaceticus RUH2202]
 gi|262257022|gb|EEY75761.1| DNA polymerase subunit III [Acinetobacter calcoaceticus RUH2202]
          Length = 382

 Score =  203 bits (517), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 124/402 (30%), Positives = 213/402 (52%), Gaps = 37/402 (9%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++ + +  +L +L H    +ER++T+ +  +V +Q N   L I  S  E+E+  +   S
Sbjct: 1   MRLKIAKESLLNVLSHVVGAVERRHTLNILSNVKIQTNAQALTITGSDLEVELVASTVLS 60

Query: 61  VDVC---GSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPES 116
              C   G  TV A  L +I + L   A I     E++      +  G+S F L + P  
Sbjct: 61  EGACLEAGETTVPARKLMEICKSLPTAALIDLQITEDQ---RCILKSGNSRFVLGTLPAE 117

Query: 117 EFPS-TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVA 175
           ++P  T E       ++    LK L E+T FAMA +++R+YL G    I+E  L+  AV 
Sbjct: 118 DYPLLTTENSQGTQVQVTQRELKRLFEKTAFAMAVQDVRFYLTGTLLEIDENQLR--AVT 175

Query: 176 TDGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESL 235
           TDGHRLA+ E+   +  A++   IVPRKAVGE+ R+LS +D  + + +    +++ I + 
Sbjct: 176 TDGHRLALCEITASSTSAQLVQAIVPRKAVGELQRLLSIEDEQLTLLIGRELLNVTINTP 235

Query: 236 S-----------MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQ 284
           S            + +LIDG+FP+Y+ VIP   DK + ++    +Q++ RV+I+S+ +++
Sbjct: 236 SRDKEQGNITVRFTTKLIDGKFPDYRRVIPRGGDKHVLISHDVFKQSLQRVAILSNEKLR 295

Query: 285 AVKLSLSSDKLCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVD- 343
            V L+ + D L +  +NP+  +AIE + + Y   P+++ FN +YLLE++       V+D 
Sbjct: 296 GVFLNFNQDSLQLRANNPEQDEAIEDLAIQYQNIPLEMSFNAQYLLEVLG------VLDG 349

Query: 344 DEVVFRLDSSNSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           D+V   +  +N SV ++      +          YV+MPMR+
Sbjct: 350 DDVNMSMSEANQSVLVQDPAHSDQT---------YVVMPMRV 382


>gi|157959832|ref|YP_001499866.1| DNA polymerase III subunit beta [Shewanella pealeana ATCC 700345]
 gi|157844832|gb|ABV85331.1| DNA polymerase III, beta subunit [Shewanella pealeana ATCC 700345]
          Length = 366

 Score =  203 bits (516), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 121/389 (31%), Positives = 215/389 (55%), Gaps = 27/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK +++R  +L+ L      +ER++ +P+  ++L++ ++  L++  +  E+E+ G +   
Sbjct: 1   MKFSIDRDALLKPLQLVSGAVERRHNLPILANLLVEVSNHSLKLTGTDLEVELVGEVQLE 60

Query: 61  VDVC-GSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESEF 118
            ++  G  TV A    DIV+ L D  ++    +EN L     +  G S F L + P  E+
Sbjct: 61  GEILEGRTTVPAKKFLDIVKSLPDQVELKIEQQENRLL----LRSGRSRFTLATLPAEEY 116

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P+    E    F L    +K+L++ T F+MA +++RYYLNG+      E   L A+ATDG
Sbjct: 117 PNVDAFEAEIEFTLKQGTMKSLIDATQFSMANQDVRYYLNGLLLET--EGNVLRAIATDG 174

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA++   I A + +   +IVPRK V E++R   + D  V +++ ++ I     +   +
Sbjct: 175 HRLALSHRMIEASLPE-KQVIVPRKGVLELMRSFEADDLDVTIAIGDNAIRATTATAVFT 233

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +L+DG FP+Y+ V+P   DK +  +   L+QA+ R SI+S+ + + V++ L ++ + +T
Sbjct: 234 SKLVDGRFPDYRRVLPKGGDKVVIASRLQLKQALLRASILSNEKFRGVRVQLENNLIKIT 293

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
            +NP+  +A E ++V Y   P++I FN  YLL++++N+ S     D+V   L   NSS  
Sbjct: 294 ANNPEQEEAEEILDVEYENTPLEIGFNVSYLLDVLNNLPS-----DDVRITLIDGNSSAL 348

Query: 359 IRGKDKDSKNNKDNKV--NAFYVLMPMRI 385
           I           DN +  ++ YV+MPMR+
Sbjct: 349 I-----------DNHIEQDSMYVVMPMRL 366


>gi|187930915|ref|YP_001890899.1| DNA polymerase III, beta subunit [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|187711824|gb|ACD30121.1| DNA polymerase III, beta subunit [Francisella tularensis subsp.
           mediasiatica FSC147]
          Length = 367

 Score =  203 bits (516), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 126/389 (32%), Positives = 223/389 (57%), Gaps = 26/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M   + R D+L+ L     +   K+T+P+   +L   ++  L+I AS  + EI+  I  S
Sbjct: 1   MNFVLNRDDLLKPLQSMLSVANSKSTMPLLSCILFDIDNNNLKITASDLDTEISCNIAVS 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP- 119
            +    + ++A  +Y+IVR L + + I F + NE   +V I   +S F L S     +P 
Sbjct: 61  CNTTIKLALNADKIYNIVRSLNENSMIDF-RINE--NKVTIVSNNSTFNLISLNADNYPL 117

Query: 120 --STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATD 177
             S   E+   SF+L+     +++ +  F+MA ++ RY+LNG+F+ IN   L+  AV+TD
Sbjct: 118 IDSNINEQA--SFDLSQQDFHHIISKVDFSMANDDTRYFLNGMFWEINANLLR--AVSTD 173

Query: 178 GHRLAVAEVDIVAQIAKMPS-IIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLS 236
           GHR+++ E  I +++    S  I+P+KA+ E+ +I+   + ++K+ L ++ +     + +
Sbjct: 174 GHRMSITEAIIDSKVLDSASKSIIPKKAILELKKIVGKTEENIKICLGKNYLKAIFGNYA 233

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
              +LIDG +P+YQ VIP +N K L V+    + ++ R SI+++ + + V+L++S ++L 
Sbjct: 234 FISKLIDGRYPDYQKVIPKNNTKLLAVDKQFFKNSLLRTSILANDKYKGVRLNISQNQLL 293

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           ++ +NPD  KA + + V YN+ PM+ICFNYKYLL+II N+ S+E +       LD+ N S
Sbjct: 294 LSANNPDNEKAEDKIEVQYNDQPMEICFNYKYLLDII-NVLSEETMS----IYLDNPNMS 348

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +          KD K N+ +++MPM+I
Sbjct: 349 ALV----------KDEKDNSLFIIMPMKI 367


>gi|331007622|ref|ZP_08330764.1| DNA polymerase III beta subunit [gamma proteobacterium IMCC1989]
 gi|330418562|gb|EGG93086.1| DNA polymerase III beta subunit [gamma proteobacterium IMCC1989]
          Length = 369

 Score =  203 bits (516), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 125/389 (32%), Positives = 216/389 (55%), Gaps = 24/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK +V R  +L  L     ++ER+ T+PV  +VL+   +  L +  +  E+EI   +P  
Sbjct: 1   MKFSVSREALLVPLQLVAGVVERRQTLPVLANVLVVLENETLSLTGTDLEVEIVARLPLE 60

Query: 61  --VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEF 118
             V   G IT+ A  L DI R L DGA + F  + +   +V +  G S F L + P ++F
Sbjct: 61  NPVQDTGEITIPAKKLVDICRSLPDGATVEFILQED--QKVIVKSGRSRFTLATLPSNDF 118

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           PST++ E    F  + S++K L++RT FAMA +++RYYLNG+ + +  E  +L  VATDG
Sbjct: 119 PSTEKSEGDLQFSCSQSIIKRLIDRTAFAMAQQDVRYYLNGMLWEV--EGNRLRCVATDG 176

Query: 179 HRLA--VAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLS 236
           HRLA  V E+DI   + +    I+PRK V E+ R+L+ +++ + ++L    I ++  + +
Sbjct: 177 HRLAMCVRELDI--DVPEKSQAILPRKGVIELSRLLNDQEAQIDLTLGTHHIRVDTPNYT 234

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
            + +L+DG+FP+Y+ V+P      +  N T L+QA  R +I+S+ + + V+L+ +   L 
Sbjct: 235 FTSKLVDGKFPDYERVLPKGGTNVVLGNRTELKQAFARTAILSNEKYRGVRLNFTEGLLN 294

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           +  +NP+  +A E + + Y    ++I FN  YL +I   +++     + V   L  +NSS
Sbjct: 295 IVANNPEQEEAEEQVVIDYKGDEIEIGFNVSYLQDITSVLNT-----ENVKITLSDANSS 349

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +   ++          ++ YV+MPMR+
Sbjct: 350 ALLEEPEEG---------DSVYVVMPMRL 369


>gi|56707189|ref|YP_169085.1| DNA polymerase III, beta chain [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|89255451|ref|YP_512812.1| DNA polymerase III, beta chain [Francisella tularensis subsp.
           holarctica LVS]
 gi|110669659|ref|YP_666216.1| DNA polymerase III, beta chain [Francisella tularensis subsp.
           tularensis FSC198]
 gi|115313983|ref|YP_762706.1| DNA-directed DNA polymerase [Francisella tularensis subsp.
           holarctica OSU18]
 gi|134301171|ref|YP_001121139.1| DNA polymerase III, beta subunit [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|156501372|ref|YP_001427436.1| DNA polymerase III, subunit beta [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|208780098|ref|ZP_03247441.1| DNA polymerase III, beta subunit [Francisella novicida FTG]
 gi|254366861|ref|ZP_04982899.1| DNA polymerase III, beta chain [Francisella tularensis subsp.
           holarctica 257]
 gi|254368433|ref|ZP_04984450.1| DNA polymerase III [Francisella tularensis subsp. holarctica
           FSC022]
 gi|254371403|ref|ZP_04987404.1| DNA polymerase III [Francisella tularensis subsp. tularensis
           FSC033]
 gi|56603681|emb|CAG44635.1| DNA polymerase III, beta chain [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|89143282|emb|CAJ78443.1| DNA polymerase III, beta chain [Francisella tularensis subsp.
           holarctica LVS]
 gi|110319992|emb|CAL08018.1| DNA polymerase III, beta chain [Francisella tularensis subsp.
           tularensis FSC198]
 gi|115128882|gb|ABI82069.1| DNA-directed DNA polymerase [Francisella tularensis subsp.
           holarctica OSU18]
 gi|134048948|gb|ABO46019.1| DNA polymerase III, beta subunit [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|134252689|gb|EBA51783.1| DNA polymerase III, beta chain [Francisella tularensis subsp.
           holarctica 257]
 gi|151569642|gb|EDN35296.1| DNA polymerase III [Francisella tularensis subsp. tularensis
           FSC033]
 gi|156251975|gb|ABU60481.1| DNA polymerase III, beta subunit [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|157121327|gb|EDO65528.1| DNA polymerase III [Francisella tularensis subsp. holarctica
           FSC022]
 gi|208744102|gb|EDZ90403.1| DNA polymerase III, beta subunit [Francisella novicida FTG]
 gi|282158288|gb|ADA77679.1| DNA polymerase III, beta subunit [Francisella tularensis subsp.
           tularensis NE061598]
          Length = 367

 Score =  203 bits (516), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 126/389 (32%), Positives = 223/389 (57%), Gaps = 26/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M   + R D+L+ L     +   K+T+P+   +L   ++  L+I AS  + EI+  I  S
Sbjct: 1   MNFVLNRDDLLKPLQSMLSVANSKSTMPLLSCILFDIDNNNLKITASDLDTEISCNIAVS 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP- 119
            +    + ++A  +Y+IVR L + + I F + NE   +V I   +S F L S     +P 
Sbjct: 61  CNTTIKLALNADKIYNIVRSLNENSMIDF-RINE--NKVTIVSNNSTFNLISLNADNYPL 117

Query: 120 --STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATD 177
             S   E+   SF+L+     +++ +  F+MA ++ RY+LNG+F+ IN   L+  AV+TD
Sbjct: 118 IDSNINEQA--SFDLSQQDFHHIISKVDFSMANDDTRYFLNGMFWEINANLLR--AVSTD 173

Query: 178 GHRLAVAEVDIVAQIAKMPS-IIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLS 236
           GHR+++ E  I +++    S  I+P+KA+ E+ +I+   + ++K+ L ++ +     + +
Sbjct: 174 GHRMSITEAIIDSKVLDSASQSIIPKKAILELKKIVGKTEENIKICLGKNYLKAIFGNYA 233

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
              +LIDG +P+YQ VIP +N K L V+    + ++ R SI+++ + + V+L++S ++L 
Sbjct: 234 FISKLIDGRYPDYQKVIPKNNTKLLAVDKQFFKNSLLRTSILANDKYKGVRLNISQNQLL 293

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           ++ +NPD  KA + + V YN+ PM+ICFNYKYLL+II N+ S+E +       LD+ N S
Sbjct: 294 LSANNPDNEKAEDKIEVQYNDQPMEICFNYKYLLDII-NVLSEETMS----IYLDNPNMS 348

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +          KD K N+ +++MPM+I
Sbjct: 349 ALV----------KDEKDNSLFIIMPMKI 367


>gi|301154704|emb|CBW14167.1| DNA polymerase III, beta subunit [Haemophilus parainfluenzae T3T1]
          Length = 366

 Score =  203 bits (516), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 124/386 (32%), Positives = 213/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ ++ R ++L+ L   C ++  +  IPV  +VLLQ  D  L I  +  E+E++     S
Sbjct: 1   MQFSISRENLLKPLQQVCGVLSNRPNIPVLNNVLLQIEDNRLTITGTDLEVELSSYTQLS 60

Query: 61  VDVC-GSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ T+ A    DI R L D  +I+   E +      +  G S F L + P  E+P
Sbjct: 61  SSTADGAFTIPAKKFLDICRTLSDEFEITVTFEEDRAI---VESGRSKFNLTTLPAEEYP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  S L+ L+E T F+MA ++ RY+LNG+ F      L+   VATDGH
Sbjct: 118 NLTDWQSEVDFALPQSTLRRLIEATQFSMANQDARYFLNGMKFETEGNLLR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  +++  Q  +  S+I+PRK V E+ R+L S D   ++ +  + + +++  +  + 
Sbjct: 176 RLAVCTIEL-DQDLQTHSVILPRKGVLELNRLLESSDELARLQIGTNNLRIHLNHIVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +LIDG FP+Y+ V+P +  + +  N   L+QA  R SI+S+ R+++V+L+LS ++L +T 
Sbjct: 235 KLIDGRFPDYRRVLPRNATRIVEGNWETLKQAFVRASILSNERVRSVRLNLSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
            NP+   A E ++V Y    M++ FN  Y+L++++ +        +V  RL  ++SS  I
Sbjct: 295 SNPEHEVAEEIVDVNYQGEEMEVGFNVTYILDVLNALKC-----QQVRIRLTDASSSCLI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
                  +N++D   +A YV+MPMR+
Sbjct: 350 -------ENSED--ASAEYVIMPMRL 366


>gi|325577774|ref|ZP_08148049.1| DNA-directed DNA polymerase III beta subunit [Haemophilus
           parainfluenzae ATCC 33392]
 gi|325160519|gb|EGC72645.1| DNA-directed DNA polymerase III beta subunit [Haemophilus
           parainfluenzae ATCC 33392]
          Length = 367

 Score =  203 bits (516), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 124/386 (32%), Positives = 213/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ ++ R ++L+ L   C ++  +  IPV  +VLLQ  D  L I  +  E+E++     S
Sbjct: 2   MQFSISRENLLKPLQQVCGVLSNRPNIPVLNNVLLQIEDNRLTITGTDLEVELSSYTQLS 61

Query: 61  VDVC-GSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ T+ A    DI R L D  +I+   E +      +  G S F L + P  E+P
Sbjct: 62  SSTADGAFTIPAKKFLDICRTLSDEFEITVTFEEDRAI---VESGRSKFNLTTLPAEEYP 118

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  S L+ L+E T F+MA ++ RY+LNG+ F      L+   VATDGH
Sbjct: 119 NLTDWQSEVDFALPQSTLRRLIEATQFSMANQDARYFLNGMKFETEGNLLR--TVATDGH 176

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  +++  Q  +  S+I+PRK V E+ R+L S D   ++ +  + + +++  +  + 
Sbjct: 177 RLAVCTIEL-DQDLQTHSVILPRKGVLELNRLLESSDELARLQIGTNNLRIHLNHIVFTS 235

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +LIDG FP+Y+ V+P +  + +  N   L+QA  R SI+S+ R+++V+L+LS ++L +T 
Sbjct: 236 KLIDGRFPDYRRVLPRNATRIVEGNWETLKQAFVRASILSNERVRSVRLNLSENQLKITA 295

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
            NP+   A E ++V Y    M++ FN  Y+L++++ +        +V  RL  ++SS  I
Sbjct: 296 SNPEHEVAEEIVDVNYQGEEMEVGFNVTYILDVLNALKC-----QQVRIRLTDASSSCLI 350

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
                  +N++D   +A YV+MPMR+
Sbjct: 351 -------ENSED--ASAEYVIMPMRL 367


>gi|197286951|ref|YP_002152823.1| DNA polymerase III subunit beta [Proteus mirabilis HI4320]
 gi|227354808|ref|ZP_03839225.1| DNA polymerase III beta subunit [Proteus mirabilis ATCC 29906]
 gi|118801|sp|P22838|DPO3B_PROMI RecName: Full=DNA polymerase III subunit beta
 gi|150879|gb|AAA83959.1| DNA polymerase III beta subunit [Proteus mirabilis]
 gi|194684438|emb|CAR46154.1| DNA polymerase III beta subunit [Proteus mirabilis HI4320]
 gi|227165126|gb|EEI49957.1| DNA polymerase III beta subunit [Proteus mirabilis ATCC 29906]
          Length = 367

 Score =  203 bits (516), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 116/344 (33%), Positives = 199/344 (57%), Gaps = 10/344 (2%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  +ER  +L+ L      +  + T+P+  ++LL+  +  L +  +  E+E+   +  S
Sbjct: 1   MKFIIEREQLLKPLQQVSGPLGGRPTLPILGNLLLKVTENTLSLTGTDLEMEMMARVSLS 60

Query: 61  VD-VCGSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEF 118
                G+ TV A   +DI R L +GA+IS     EL G  + +  G S F L + P S+F
Sbjct: 61  QSHEIGATTVPARKFFDIWRGLPEGAEISV----ELDGDRLLVRSGRSRFSLSTLPASDF 116

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P+  + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+ +L  VATDG
Sbjct: 117 PNLDDWQSEVEFTLPQATLKRLIESTQFSMAHQDVRYYLNGMLFET--ENTELRTVATDG 174

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRIL-SSKDSSVKVSLSESRIHLNIESLSM 237
           HRLAV  +DI  Q     S+IVPRK V E++R+L  S +S +++ +  + +  ++     
Sbjct: 175 HRLAVCAMDI-GQSLPGHSVIVPRKGVIELMRLLDGSGESLLQLQIGSNNLRAHVGDFIF 233

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +L+DG FP+Y+ V+P +  K +   C  L+QA  R +I+S+ + + V+++L++ +L +
Sbjct: 234 TSKLVDGRFPDYRRVLPKNPTKTVIAGCDILKQAFSRAAILSNEKFRGVRINLTNGQLKI 293

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEV 341
           T +NP+  +A E ++V Y    M+I FN  YLL++++ +  +EV
Sbjct: 294 TANNPEQEEAEEIVDVQYQGEEMEIGFNVSYLLDVLNTLKCEEV 337


>gi|70733515|ref|YP_257154.1| DNA polymerase III subunit beta [Pseudomonas fluorescens Pf-5]
 gi|68347814|gb|AAY95420.1| DNA polymerase III, beta subunit [Pseudomonas fluorescens Pf-5]
          Length = 367

 Score =  202 bits (515), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 123/389 (31%), Positives = 213/389 (54%), Gaps = 26/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAI--- 57
           M  T++R  +L+ L     ++ER+ T+PV  +VLL      L +  +  E+E+ G +   
Sbjct: 1   MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLTGTDLEVELVGRVQLE 60

Query: 58  -PASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPES 116
            PA     G ITV A  L DI + L + A I    + +   ++ +  G S F L + P +
Sbjct: 61  EPAE---PGEITVPARKLMDICKSLPNDALIDIKVDEQ---KLVVKAGRSRFTLSTLPAN 114

Query: 117 EFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVAT 176
           +FP+ +E     + +L  S L+ L+ERT FAMA +++RYYLNG+   ++   ++  AVAT
Sbjct: 115 DFPTVEEGPGSLTCQLEQSRLRRLIERTSFAMAQQDVRYYLNGMLLEVSAGIIR--AVAT 172

Query: 177 DGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLS 236
           DGHRLA+  +           +IVPRK + E+ R+L+  D +V + L +  I       +
Sbjct: 173 DGHRLAMCSMQADIGQPDRHQVIVPRKGILELARLLTEPDGNVSIVLGQHHIRATTGEFT 232

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
            + +L+DG+FP+Y+ V+P   DK +  +   LR+A  R +I+S+ + + ++L L++ +L 
Sbjct: 233 FTSKLVDGKFPDYERVLPKGGDKLVLGDRQALREAFSRTAILSNEKYRGIRLQLANGQLK 292

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           +  +NP+  +A E + V YN   ++I FN  YLL+++  +++     ++V   L  SNSS
Sbjct: 293 IQANNPEQEEAEEEVGVEYNGGSLEIGFNVSYLLDVLGVMTT-----EQVRLILSDSNSS 347

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             ++  D D         ++ YV+MPMR+
Sbjct: 348 ALVQESDND---------DSAYVVMPMRL 367


>gi|119773156|ref|YP_925896.1| DNA-directed DNA polymerase [Shewanella amazonensis SB2B]
 gi|119765656|gb|ABL98226.1| DNA polymerase III, beta subunit [Shewanella amazonensis SB2B]
          Length = 366

 Score =  202 bits (515), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 125/386 (32%), Positives = 217/386 (56%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK +++R  +L+ L      +ER++ +P+  ++L++ +   L++  +  E+E+ G     
Sbjct: 1   MKFSIDRDALLKPLQLVSGAVERRHNLPILANLLVEVSGHSLKMTGTDLEVELVGEATVH 60

Query: 61  VDVC-GSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            DV  G  TV A  L DIV+ L +  +I   ++     +  +  G S F L + P  E+P
Sbjct: 61  GDVQEGRTTVPAKKLLDIVKSLPEQTEIKVEQQE---NKWLLRCGRSRFSLATLPAEEYP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + +       F L    LK+L++ T F+MA +++RYYLNG+   I  E   L AVATDGH
Sbjct: 118 NVEAFRPDIEFTLKQGTLKSLIDSTQFSMANQDVRYYLNGLL--IETEGNVLRAVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA++   I A + +   +IVPRK V E+ R+L ++D  + +++ ES I     +   + 
Sbjct: 176 RLALSHRMIEASLPE-KQVIVPRKGVVELSRLLDAEDQDITLAIGESAIRATTATAVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P   DK +  +   L+QA+ R SI+S+ + + V++ L    L +T 
Sbjct: 235 KLVDGRFPDYRRVLPKGGDKIVIASRNQLKQALLRASILSNEKFRGVRILLEDGLLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E ++V YN   ++I FN  YLL++++++ SDEV     V  +DS++S++  
Sbjct: 295 NNPEQEEAEEIIDVDYNSTTLEIGFNVSYLLDVLNSLRSDEV----RVTLIDSNSSALIE 350

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              ++DS           YV+MPMR+
Sbjct: 351 NHVEEDS----------MYVVMPMRL 366


>gi|157373148|ref|YP_001471748.1| DNA-directed DNA polymerase [Shewanella sediminis HAW-EB3]
 gi|157315522|gb|ABV34620.1| DNA-directed DNA polymerase [Shewanella sediminis HAW-EB3]
          Length = 366

 Score =  202 bits (515), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 119/387 (30%), Positives = 214/387 (55%), Gaps = 23/387 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK +++R  +L+ L      +ER++ +P+  ++L++ +   L++  +  E+E+ G +   
Sbjct: 1   MKFSIDRDALLKPLQLVTGAVERRHNLPILANLLVEVSGHSLKMTGTDLEVELVGQVQLE 60

Query: 61  VDVC-GSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESEF 118
            DV  G  T+ A    DIV+ L D  ++    +EN L     +  G S F L + P  E+
Sbjct: 61  GDVQEGRTTIPAKKFLDIVKSLPDQVELKIEQQENRL----LLRSGRSRFTLATLPAEEY 116

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P+ +  +    F +    LK+L++ T F+MA +++RYYLNG+      E   L A+ATDG
Sbjct: 117 PNVEAFQADIEFTIKQGTLKSLIDATQFSMANQDVRYYLNGLLLET--EGNVLRAIATDG 174

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA++   +V +      +IVPRK V E+ R+   +D  + +++ ++ I     S   +
Sbjct: 175 HRLALSH-RMVEESLPEKQVIVPRKGVVELQRLFEGEDLDITIAIGDNAIRATTGSAVFT 233

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +L+DG FP+Y+ V+P   DK +  +  +L+QA+ R SI+S+ + + V++ L ++ + +T
Sbjct: 234 SKLVDGRFPDYRRVLPKGGDKIVIASRNHLKQALLRASILSNEKFRGVRVQLENNLIKIT 293

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
            +NP+  +A E ++V Y   P++I FN  YLL++++N+ S     D+V   L   NSS  
Sbjct: 294 ANNPEQEEAEEILDVEYENTPLEIGFNVSYLLDVLNNLPS-----DDVRITLIDGNSSAL 348

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           I    ++         N+ YV+MPMR+
Sbjct: 349 IENHIEE---------NSMYVVMPMRL 366


>gi|167621943|ref|YP_001672237.1| DNA polymerase III subunit beta [Shewanella halifaxensis HAW-EB4]
 gi|167351965|gb|ABZ74578.1| DNA polymerase III, beta subunit [Shewanella halifaxensis HAW-EB4]
          Length = 366

 Score =  202 bits (514), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 122/389 (31%), Positives = 214/389 (55%), Gaps = 27/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK +++R  +L+ L      +ER++ +P+  ++L++ +   L++  +  E+E+ G +   
Sbjct: 1   MKFSIDRDALLKPLQLVSGAVERRHNLPILANLLVEVSGHSLKMTGTDLEVELVGEVQLE 60

Query: 61  VDVC-GSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESEF 118
            +V  G  TV A    DIV+ L D  ++    +EN L     +  G S F L + P  E+
Sbjct: 61  GEVVEGRTTVPAKKFLDIVKSLPDQVELKIEQQENRL----LLRSGRSRFTLATLPAEEY 116

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P+    E    F L    +K+L++ T F+MA +++RYYLNG+      E   L A+ATDG
Sbjct: 117 PNVDAFEAEIEFTLKQGTMKSLIDATQFSMANQDVRYYLNGLLLET--EGNVLRAIATDG 174

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA++   I A + +   +IVPRK V E++R   + D  V +++ ++ I     +   +
Sbjct: 175 HRLALSHRMIEASLPE-KQVIVPRKGVLELMRSFEADDLDVTIAIGDNAIRATTATAVFT 233

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +L+DG FP+Y+ V+P   DK +  +   L+QA+ R SI+S+ + + V++ L ++ + +T
Sbjct: 234 SKLVDGRFPDYRRVLPKGGDKIVIASRLQLKQALLRASILSNEKFRGVRVQLENNLIKIT 293

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
            +NP+  +A E ++V Y   P++I FN  YLL++++N+ S     D+V   L   NSS  
Sbjct: 294 ANNPEQEEAEEILDVEYENTPLEIGFNVSYLLDVLNNLPS-----DDVRITLIDGNSSAL 348

Query: 359 IRGKDKDSKNNKDNKV--NAFYVLMPMRI 385
           I           DN +  ++ YV+MPMR+
Sbjct: 349 I-----------DNHIEQDSMYVVMPMRL 366


>gi|127510937|ref|YP_001092134.1| DNA polymerase III, beta subunit [Shewanella loihica PV-4]
 gi|126636232|gb|ABO21875.1| DNA polymerase III, beta subunit [Shewanella loihica PV-4]
          Length = 366

 Score =  202 bits (514), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 118/386 (30%), Positives = 212/386 (54%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK +++R  +L+ L      +ER++ +P+  ++L++ +   L++  +  E+E+ G     
Sbjct: 1   MKFSIDRDALLKPLQLVSGAVERRHNLPILANLLVEVSGHSLKLTGTDLEVELVGQAELQ 60

Query: 61  VDVC-GSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +V  G  TV A    DIV+ L D  ++   +++     + +  G S F L + P  E+P
Sbjct: 61  GEVQEGRTTVPAKKFLDIVKSLPDQVELKIEQQD---NRLLLRSGRSRFTLATLPAEEYP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +    +    F L    LK+L++ T F+MA +++RYYLNG+      E   L A+ATDGH
Sbjct: 118 NVDAFQADIEFTLKQGTLKSLIDATQFSMANQDVRYYLNGLLLET--EGNVLRAIATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA++   +V        +IVPRK V E+ R+   +D  V +S+ E+ I    +S   + 
Sbjct: 176 RLALSH-RMVQDSLPEKQVIVPRKGVLELQRLFEGEDLDVTLSIGENAIRATTQSAVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P   DK +  +  +L+QA+ R SI+S+ + + V++ L  + + +T 
Sbjct: 235 KLVDGRFPDYRRVLPKGGDKIVIASRNHLKQALLRASILSNEKFRGVRVQLEQNLIKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E +++ Y+  P++I FN  YLL++++N+ S     D+V   L   NSS  I
Sbjct: 295 NNPEQEEAEEILDIEYDNAPLEIGFNVSYLLDVLNNLPS-----DDVRITLIDGNSSALI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
               ++         ++ YV+MPMR+
Sbjct: 350 ENHVEE---------DSMYVVMPMRL 366


>gi|78484348|ref|YP_390273.1| DNA polymerase III, beta subunit [Thiomicrospira crunogena XCL-2]
 gi|78362634|gb|ABB40599.1| DNA polymerase III, beta subunit [Thiomicrospira crunogena XCL-2]
          Length = 368

 Score =  202 bits (514), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 119/386 (30%), Positives = 214/386 (55%), Gaps = 19/386 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           MKI++ R ++L++L     ++E++ T+P+  ++L Q N   L + AS  EIE   +    
Sbjct: 1   MKISLSRENLLKVLQTVGGVVEKRQTMPILANILFQVNQNTLTVTASDLEIETRASTELE 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
           S D   S+T+ A  L  IVR L DG  I   + +E+     +S G S F L + P  +FP
Sbjct: 61  SSDGDFSVTLPAVKLISIVRSLPDGLTI-LLEFDEM--RCQLSAGRSRFKLSTLPADDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +    +   SF +A   LK ++  T FAMA++++R+YLNG+ F I+ + L++  VATDGH
Sbjct: 118 TIDLTQTELSFSMAQHQLKQIIHNTAFAMASQDVRFYLNGMLFDISNQTLRV--VATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RL+     +  +       I+PRK V E+ +++   DS +  SL+++ + +  E    + 
Sbjct: 176 RLSTCSTLLETEGLTATQAILPRKGVLELQKLIGDDDSLIAFSLAKNYLTVQFEETVFTC 235

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP++  V+P  ND+ ++ +   LR  + R +I+S+ + + ++L+LS + L +  
Sbjct: 236 KLVDGRFPDFNRVLPQHNDQLVQTDRELLRSLLQRAAILSNDKFKGIRLALSQNLLAVHA 295

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
            N D  ++ E M + YN   M+I FN  YLL++++++      ++ V   +  +NSS  +
Sbjct: 296 QNSDQDESHEDMAIDYNGTEMEIGFNVNYLLDVLNSMH-----EEAVTLYMKDANSSCMV 350

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
                D++N      +  +V+MPMR+
Sbjct: 351 -----DTQN---ETCHCQHVIMPMRL 368


>gi|149191877|ref|ZP_01870111.1| DNA polymerase III subunit beta [Vibrio shilonii AK1]
 gi|148834269|gb|EDL51272.1| DNA polymerase III subunit beta [Vibrio shilonii AK1]
          Length = 320

 Score =  202 bits (514), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 106/322 (32%), Positives = 186/322 (57%), Gaps = 20/322 (6%)

Query: 64  CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPSTKE 123
            GS+TV +    DI R L D + I+   E   G  V +  G S F L + P S+FP+ ++
Sbjct: 19  AGSVTVPSRKFLDICRGLPDDSTITIVLE---GDRVQVRSGRSRFSLSTLPASDFPNIED 75

Query: 124 EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAV 183
            +   +  +  + LK+L+E+T F+MA +++RYYLNG+ F +++  L+  +VATDGHR+AV
Sbjct: 76  WQQEVAVTVTQAELKSLIEKTQFSMANQDVRYYLNGMLFELDQNTLR--SVATDGHRMAV 133

Query: 184 AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID 243
           A V +         IIVPRK V E+ ++L + +  V + +  S I   + +   + +L+D
Sbjct: 134 ALVSLEGSFDN-KQIIVPRKGVQELSKLLDAPEQPVTLQIGSSNIRAEVNNFVFTSKLVD 192

Query: 244 GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPD 303
           G FP+Y+ V+P + DK L  NC  LRQA  R +I+S+ + + V+++L  +++ +T +NP+
Sbjct: 193 GRFPDYRRVLPQNTDKTLEANCDELRQAFSRAAILSNEKFRGVRVNLDQNEMRITANNPE 252

Query: 304 MGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIRGKD 363
             +A E ++V +    ++I FN  Y+L++++ +       D+V   + ++N+S  I   +
Sbjct: 253 QEEAEEMLDVEFQGDALEIGFNVSYVLDVLNTLRC-----DQVRISMSNANASALIENSE 307

Query: 364 KDSKNNKDNKVNAFYVLMPMRI 385
            DS         A YV+MP+R+
Sbjct: 308 DDS---------AMYVVMPIRL 320


>gi|238898808|ref|YP_002924490.1| DNA polymerase III, beta-subunit [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
 gi|229466568|gb|ACQ68342.1| DNA polymerase III, beta-subunit [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
          Length = 368

 Score =  202 bits (514), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 126/388 (32%), Positives = 217/388 (55%), Gaps = 23/388 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  +ER  +L+ L      +  + T+P+  ++LLQ N+ +L + A+  ++E+   +  S
Sbjct: 1   MKFIIEREHLLKPLQQVISPLSARPTMPILGNLLLQVNENVLFLTATDLQMEMVVRVVLS 60

Query: 61  ---VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESE 117
              +   GS TV A   +DI R L +G+ I+   +   G  + +  G S F L + P S 
Sbjct: 61  HSDLHESGSTTVPARKFFDIWRGLLEGSTITVTLD---GDRLLVYSGRSRFSLSTLPSSG 117

Query: 118 FPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATD 177
           FP   + +   +F L    LK L++ T F+MA +++RYYLNG+ F    ++L+   VATD
Sbjct: 118 FPGLDDWKTQVAFSLPQETLKKLIDATQFSMAHQDVRYYLNGMLFETENKELR--TVATD 175

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLAV  +     +    S+IVPRK V E+ R+L +    VK+ + E  I  ++++L+ 
Sbjct: 176 GHRLAVCSMSTDETLPSY-SVIVPRKGVIELGRLLEASVHPVKLHIGEHNIRAHLDNLTF 234

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +LID  FP+Y+ V+P + +K L   C  L+QA  RV+I+S+ + + V+L LS +++ +
Sbjct: 235 TCKLIDARFPDYRRVLPKNPNKILEAKCDLLKQAFSRVAILSNEKFRGVRLYLSHNQMKI 294

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           T +NP+  +A E +++ Y    ++I  N  Y+L+I++ +       D+V F L ++ SS+
Sbjct: 295 TANNPEQEEAEEILDIEYEGEELEIGLNVSYILDILNILKC-----DKVRFLLINAASSL 349

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            I  +D  S+          Y+LMPMR+
Sbjct: 350 QI--EDHSSQ-------MVSYILMPMRL 368


>gi|304309654|ref|YP_003809252.1| DNA polymerase sliding clamp subunit (PcnA homolog) [gamma
           proteobacterium HdN1]
 gi|301795387|emb|CBL43585.1| DNA polymerase sliding clamp subunit (PcnA homolog) [gamma
           proteobacterium HdN1]
          Length = 367

 Score =  202 bits (514), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 120/386 (31%), Positives = 205/386 (53%), Gaps = 20/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  V R  IL+ L     ++ER+ T P+  ++LL  +   L +  +  E+E+   I   
Sbjct: 1   MKFKVIREGILKPLQQLAGLVERRQTKPILANILLVLDGNALTLTGTDTEVELRARIQLG 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            +   G  T+ A  L DI + L +GA++    +++   +  +  G S F L + P  +FP
Sbjct: 61  EEYPFGRATLPAKKLLDICKSLPEGAELLIEADDQ---KALLRSGRSKFSLVALPPDDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
             ++ ++   F +    L+ L+E+T FAMA +++R+YLNG+   ++E +L+  AVATDGH
Sbjct: 118 DLEDGQFEVQFSIQQRYLRELIEKTGFAMAQQDVRFYLNGMLLEVSENNLR--AVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA+ + DI+ Q A +   +VPRK + EI ++  S D  + +SLS + +      L  + 
Sbjct: 176 RLALGDRDILWQGAGIRQAVVPRKGILEIPKLFGSDDGELLISLSGNHLRAETADLRFTS 235

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+D ++P Y  V+P   ++ +  +   LRQ + RV I+S+ + + V+L+     L    
Sbjct: 236 KLLDAKYPEYGRVLPKPGERYIVADRDALRQCLLRVGILSNEKFRGVRLTFQCGVLVARA 295

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
            NP+  +A ES+ V YN    +I FN  YLL+++  + S     + V   L  +N++  I
Sbjct: 296 SNPEQEEAEESVVVDYNGADTEIAFNIGYLLDVLGVVKS-----ESVSISLADANNTALI 350

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
           R          D+K    YV+MPMRI
Sbjct: 351 R-------ETVDDKT--LYVVMPMRI 367


>gi|58584686|ref|YP_198259.1| DNA polymerase III beta clamp subunit [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
 gi|58419002|gb|AAW71017.1| DNA polymerase III beta clamp subunit [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
          Length = 393

 Score =  201 bits (512), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 125/384 (32%), Positives = 215/384 (55%), Gaps = 20/384 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+  + R+ +L  L     ++ER+N I +   + ++A  G +++ A+  +I I  ++ A 
Sbjct: 29  MRFRIGRTSLLSTLSRVSGVVERRNAIDILACINIKAQHGSIKLMATDLDISIFASLAAD 88

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V   G + VSAH L+DIV+KL     ++F + N+ G ++ IS+G++NF L +   ++ P 
Sbjct: 89  VLTEGEVKVSAHTLHDIVKKLPADLDVNF-EVNDQG-KLLISYGNANFSLPNVVLNKLPV 146

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
            +E ++ Y F L ++ L +L+ +T FA++ ++ RY LNGI+ H +E+   L  VATDGHR
Sbjct: 147 LEEGDHKYDFTLLNTDLIDLLNKTKFAVSLDDTRYNLNGIYLHTDEQ--FLYCVATDGHR 204

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           L+  +      I     +I+PRK V E+L++L   D  + + LS+ +I        +  +
Sbjct: 205 LSCVKKPKPQNINSEFGVIIPRKTVIELLKVLDDCDE-INIKLSDRKIKFTCGKYIIISK 263

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDG FP+Y+ VIP S DK++ V  + L   +DRVS++ S RI++++ SL    L +  +
Sbjct: 264 LIDGAFPDYKCVIPASQDKQMVVESSKLASVIDRVSVVVSDRIKSIEFSLQEKSLTLHSN 323

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           + +   A E + V YN  P++I FN +YLL+ +  I S      +  F L  S+S+  I 
Sbjct: 324 SQECSDATEFIEVDYNGAPIEIGFNSRYLLDALSCIKS------KCKFSLSDSSSATVI- 376

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMR 384
                     +N  N  Y++MP+R
Sbjct: 377 --------TDENDPNVLYIVMPVR 392


>gi|148980123|ref|ZP_01815903.1| DNA polymerase III subunit beta [Vibrionales bacterium SWAT-3]
 gi|145961424|gb|EDK26730.1| DNA polymerase III subunit beta [Vibrionales bacterium SWAT-3]
          Length = 356

 Score =  201 bits (512), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 110/363 (30%), Positives = 202/363 (55%), Gaps = 21/363 (5%)

Query: 24  KNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPASVDV-CGSITVSAHLLYDIVRKLQ 82
           + T+P+  ++L++  D +L + A+  E+E+   +    D   GSITV +    DI R L 
Sbjct: 14  RPTLPILGNLLIKVEDNVLSMTATDLEVELISRVTLEGDFEAGSITVPSRKFLDICRGLP 73

Query: 83  DGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPSTKEEEYVYSFELASSVLKNLVE 142
           D + I+   +   G  V +  G S F L + P ++FP+ ++        +  + L+ L+E
Sbjct: 74  DSSVITVVLD---GDRVQVRSGRSRFSLATLPAADFPNIEDWSSEVEVSVTQAELRGLIE 130

Query: 143 RTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAVAEVDIVAQIAKMPSIIVPR 202
           +T F+MA +++RYYLNG+ F I  E   L +VATDGHR+AV++  + A  A+   IIVPR
Sbjct: 131 KTQFSMANQDVRYYLNGMLFEI--EGSTLRSVATDGHRMAVSQAQLGADFAQ-KQIIVPR 187

Query: 203 KAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLIDGEFPNYQNVIPCSNDKELR 262
           K V E++++L + +  V + +  S +   + +   + +L+DG FP+Y+ V+P +  K L 
Sbjct: 188 KGVQELVKLLDAPEQPVTLQIGNSNVRAEVNNYVFTSKLVDGRFPDYRRVMPQNTTKTLE 247

Query: 263 VNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPDMGKAIESMNVYYNECPMDI 322
             C  LR A  R +I+S+ + + V+++L+  ++ +T +NP+  +A E ++V +    ++I
Sbjct: 248 AGCDELRSAFSRAAILSNEKFRGVRVNLADSEMRITANNPEQEEAEEMLDVTFEGDALEI 307

Query: 323 CFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIRGKDKDSKNNKDNKVNAFYVLMP 382
            FN  Y+L++++ +       ++V   +  +N+S  I     DS         A YV+MP
Sbjct: 308 GFNVSYVLDVLNTLRC-----EQVRISMSDANASALIENAQDDS---------AMYVVMP 353

Query: 383 MRI 385
           +R+
Sbjct: 354 IRL 356


>gi|299768252|ref|YP_003730278.1| DNA polymerase III, beta subunit [Acinetobacter sp. DR1]
 gi|298698340|gb|ADI88905.1| DNA polymerase III, beta subunit [Acinetobacter sp. DR1]
          Length = 382

 Score =  201 bits (511), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 120/401 (29%), Positives = 211/401 (52%), Gaps = 35/401 (8%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++ + +  +L +L H    +ER++T+ +  +V +Q N   L I  S  E+E+  +   +
Sbjct: 1   MRLKIAKESLLNVLSHVVGAVERRHTLNILSNVKIQTNAQALTITGSDLEVELVASTVLT 60

Query: 61  VDVC---GSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPES 116
              C   G  TV A  L +I + L   A I     E++      +  G+S F L + P  
Sbjct: 61  EGACLEAGETTVPARKLMEICKSLPTAALIDLQITEDQ---RCILKSGNSRFVLGTLPAE 117

Query: 117 EFPS-TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVA 175
           ++P  T E       ++    LK L E+T FAMA +++R+YL G    I+E  L+  AV 
Sbjct: 118 DYPLLTTENSQGTQVQVTQRELKRLFEKTAFAMAVQDVRFYLTGTLLEIDENQLR--AVT 175

Query: 176 TDGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESL 235
           TDGHRLA+ E+   +  +++   IVPRKAVGE+ R+LS +D  + + +    +++ I + 
Sbjct: 176 TDGHRLALCEITASSTSSQLVQAIVPRKAVGELQRLLSIEDEQLTLLIGRELLNVTINTP 235

Query: 236 S-----------MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQ 284
           S            + +LIDG+FP+Y+ VIP   DK + ++    +Q++ RV+I+S+ +++
Sbjct: 236 SRDKEQGDITVRFTTKLIDGKFPDYRRVIPRGGDKHVLISHDVFKQSLQRVAILSNEKLR 295

Query: 285 AVKLSLSSDKLCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDD 344
            V L+ + D L +  +NP+  +AIE + + Y   P+++ FN +YLLE++  +       D
Sbjct: 296 GVFLNFNQDSLQLRANNPEQDEAIEDLAIQYQNVPLEMSFNAQYLLEVLGVLDG-----D 350

Query: 345 EVVFRLDSSNSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +V   +  +N SV ++      +          YV+MPMR+
Sbjct: 351 DVNMSMSEANQSVLVQDPAHTDQT---------YVVMPMRV 382


>gi|170719189|ref|YP_001746877.1| DNA polymerase III subunit beta [Pseudomonas putida W619]
 gi|169757192|gb|ACA70508.1| DNA polymerase III, beta subunit [Pseudomonas putida W619]
          Length = 367

 Score =  201 bits (511), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 120/389 (30%), Positives = 213/389 (54%), Gaps = 26/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAI--- 57
           M  T++R  +L+ L     ++ER+ T+PV  +VLL      L +  +  E+E+ G +   
Sbjct: 1   MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVQGQQLSLTGTDLEVELVGRVQLE 60

Query: 58  -PASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPES 116
            PA     G ITV A  L DI + L +   I    + +   ++ +  G S F L + P +
Sbjct: 61  EPAE---PGEITVPARKLMDICKSLPNDVLIDIKVDEQ---KLLVKAGRSRFTLSTLPAN 114

Query: 117 EFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVAT 176
           +FP+ +E     +  L  S L+ L+ERT FAMA +++RYYLNG+   ++   L+  AV+T
Sbjct: 115 DFPTVEEGPGSLTCNLEQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVSRNTLR--AVST 172

Query: 177 DGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLS 236
           DGHRLA+  +    +  +   +IVPRK + E+ R+L+  +  V + L +  I  N    +
Sbjct: 173 DGHRLALCSMSAAIEQDERHQVIVPRKGILELARLLTDPEGMVSIVLGQHHIRANTGEFT 232

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
            + +L+DG+FP+Y+ V+P   DK +  +   LR+A  R +I+S+ + + ++L L++ +L 
Sbjct: 233 FTSKLVDGKFPDYERVLPKGGDKLVIGDRQALREAFSRTAILSNEKYRGIRLQLAAGQLK 292

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           +  +NP+  +A E ++V Y+   ++I FN  YLL+++  +++     ++V   L  SNSS
Sbjct: 293 IQANNPEQEEAEEEISVDYDGASLEIGFNVSYLLDVLGVMTT-----EQVRLILSDSNSS 347

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             ++    D         ++ YV+MPMR+
Sbjct: 348 ALLQEAGND---------DSSYVVMPMRL 367


>gi|241667602|ref|ZP_04755180.1| DNA-directed DNA polymerase [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254876147|ref|ZP_05248857.1| DNA polymerase III [Francisella philomiragia subsp. philomiragia
           ATCC 25015]
 gi|254842168|gb|EET20582.1| DNA polymerase III [Francisella philomiragia subsp. philomiragia
           ATCC 25015]
          Length = 367

 Score =  201 bits (511), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 125/389 (32%), Positives = 221/389 (56%), Gaps = 26/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M   + R D+L+ L     +   K+T+P+   +L   N+  L+I AS  + EI+  I  S
Sbjct: 1   MNFVLNRDDLLKPLQSMLSVANSKSTMPLLSCILFDINNNNLKITASDLDTEISCNIAVS 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP- 119
            +    + ++A  +Y+IVR L D + I F  ++    +V I   +S F L S     +P 
Sbjct: 61  CNTNVKLALNADKIYNIVRSLNDNSMIDFRIDD---NKVTIISNNSTFNLISLNADNYPL 117

Query: 120 --STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATD 177
             S   E+   SF+L+     +++ +  F+MA ++ RY+LNG+F+ IN   L+  AV+TD
Sbjct: 118 IDSNINEQA--SFDLSQQDFHHIISKVDFSMANDDTRYFLNGMFWEINSNLLR--AVSTD 173

Query: 178 GHRLAVAEVDIVAQIAKMPS-IIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLS 236
           GHR+++ E  I +++    S  I+P+KA+ E+ +I+   + ++K+ L ++ +     + +
Sbjct: 174 GHRMSITESIIDSKVLDSDSQSIIPKKAILELKKIVGKTEENIKICLGKNYLKAEFGNYA 233

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
              +LIDG +P+YQ VIP +N K L V+   L+ ++ R SI+++ + + V+L++S  ++ 
Sbjct: 234 FISKLIDGRYPDYQKVIPKNNTKLLAVDKQVLKNSLLRTSILANDKYKGVRLNISQGQVL 293

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           ++ +NPD  KA + + V YN+  M+ICFNYKYLL+II N+ S+E     +   LD+ N S
Sbjct: 294 LSANNPDNEKAEDKVEVQYNDNDMEICFNYKYLLDII-NVLSEET----MTIYLDNPNMS 348

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +          KD K N+ +++MPM+I
Sbjct: 349 ALV----------KDEKDNSLFIIMPMKI 367


>gi|167627067|ref|YP_001677567.1| DNA-directed DNA polymerase [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|167597068|gb|ABZ87066.1| DNA-directed DNA polymerase [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 367

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 125/389 (32%), Positives = 221/389 (56%), Gaps = 26/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M   + R D+L+ L     +   K+T+P+   +L   N+  L+I AS  + EI+  I  S
Sbjct: 1   MNFVLNRDDLLKPLQSMLSVANSKSTMPLLSCILFDINNNNLKITASDLDTEISCNIAVS 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP- 119
            +    + ++A  +Y+IVR L D + I F  ++    +V I   +S F L S     +P 
Sbjct: 61  CNTNIKLALNADKIYNIVRSLNDNSMIDFRIDD---NKVTIISNNSTFNLISLNADNYPL 117

Query: 120 --STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATD 177
             S   E+   SF+L+     +++ +  F+MA ++ RY+LNG+F+ IN   L+  AV+TD
Sbjct: 118 IDSNINEQA--SFDLSQQDFHHIISKVDFSMANDDTRYFLNGMFWEINSNLLR--AVSTD 173

Query: 178 GHRLAVAEVDIVAQIAKMPS-IIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLS 236
           GHR+++ E  I +++    S  I+P+KA+ E+ +I+   + ++K+ L ++ +     + +
Sbjct: 174 GHRMSITESIIDSKVLDSDSQSIIPKKAILELKKIVGKTEENIKICLGKNYLKAEFGNYA 233

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
              +LIDG +P+YQ VIP +N K L V+   L+ ++ R SI+++ + + V+L++S  ++ 
Sbjct: 234 FISKLIDGRYPDYQKVIPKNNTKLLAVDKQVLKNSLLRTSILANDKYKGVRLNISQGQVL 293

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           ++ +NPD  KA + + V YN+  M+ICFNYKYLL+II N+ S+E     +   LD+ N S
Sbjct: 294 LSANNPDNEKAEDKVEVQYNDNDMEICFNYKYLLDII-NVLSEET----MTIYLDNPNMS 348

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +          KD K N+ +++MPM+I
Sbjct: 349 ALV----------KDEKDNSLFIIMPMKI 367


>gi|88607712|ref|YP_505645.1| DNA polymerase III, beta subunit [Anaplasma phagocytophilum HZ]
 gi|88598775|gb|ABD44245.1| DNA polymerase III, beta subunit [Anaplasma phagocytophilum HZ]
          Length = 375

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 122/389 (31%), Positives = 212/389 (54%), Gaps = 26/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           +  ++ R D+L+ L +   +IER+N+I V   V ++A   ++E  ++  +I I   + A+
Sbjct: 9   LDFSISREDLLQALNYVSSVIERRNSIAVLSCVRIEAKGSVIEFTSTDLDISIEACVQAN 68

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V   G    SA LLYDIVRKL   A + F K N+   ++ ++ G++ FYL      +FP 
Sbjct: 69  VATGGVAVASAQLLYDIVRKLSGEADVRF-KLND--GKLLVACGNARFYLHVISPEKFPD 125

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
            +       F++ ++ L  L+ +T F+M+ EE RY L G++FH+++E   LC VATDGHR
Sbjct: 126 IEGSSLDCGFDIPATSLAELLNKTKFSMSVEESRYNLRGVYFHVDDE--MLCCVATDGHR 183

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSS----VKVSLSESRIHLNIESLS 236
           L++A++     +    ++I+PRK V E+L+I+          V V +S  +I    +   
Sbjct: 184 LSLAKISKPEGLHSGIAVIIPRKTVNEVLKIIGHGGGDAAQMVSVGISNRKICFRYKGYF 243

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
           M  +++DG FP+Y  +IP      + ++ + L+ AVDRVS++   +++A+KLS +  KL 
Sbjct: 244 MVSKVLDGTFPDYAAIIPTECGNSVSIDASVLQSAVDRVSVVVFDKVKAIKLSFTEGKLV 303

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           ++  + D G A E ++V Y    + I  N +YL+E++ +I        E+VF    S+ S
Sbjct: 304 LSSASSDQGDASEELSVDYEGDEVVIGLNARYLMEVLGSIKG----VCEIVF----SDGS 355

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +  KD +            +++MPMRI
Sbjct: 356 AAVLVKDGE---------YGMHIVMPMRI 375


>gi|332288918|ref|YP_004419770.1| DNA polymerase III subunit beta [Gallibacterium anatis UMN179]
 gi|330431814|gb|AEC16873.1| DNA polymerase III subunit beta [Gallibacterium anatis UMN179]
          Length = 366

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 120/386 (31%), Positives = 212/386 (54%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-A 59
           M+  V R ++L+ L   C ++  + ++PV  ++L+Q +   L +  S  E+E++  +   
Sbjct: 1   MQFIVARENLLKPLQQVCGVLNNRPSLPVLNNILVQIDGDRLTLTGSDLEVELSTFVQLE 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
           S    G+ T+ A    DI R L + AQI+   EN+    V ++   S F L + P   +P
Sbjct: 61  SSSENGTFTIPARKFLDICRSLNEDAQITVNYEND---RVLVTAERSKFNLATLPAESYP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +      +  SVL+ ++E T F+MA ++ RY+LNG+ F      L+   VATDGH
Sbjct: 118 NLTQLDVDVELNIEQSVLRRVMEATQFSMANQDARYFLNGMKFETENNVLR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + +   +    +IIVPRK V E++R+L S   +  + + +S I +++ ++  + 
Sbjct: 176 RLAVCGIQLQQNVPDY-AIIVPRKGVIELMRLLDSNSENAYIRMGQSNIQVHLNNVIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +LIDG FP+Y+ V+P + D+ L V+  +L+QA  R +I+S+ R + V+L + +++L +  
Sbjct: 235 KLIDGRFPDYRRVLPKNADRILEVDWNSLKQACIRAAILSNERFRGVRLIIEANQLKILA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
            NPD  +A E ++V Y   PM++ FN  Y+L++++ +         V  RL  + SS  I
Sbjct: 295 QNPDQEEAEEVIDVSYQGEPMEVGFNVSYILDVLNALKC-----QSVRMRLTDATSSCLI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              ++          NA YV+MPMR+
Sbjct: 350 EDCEQS---------NAEYVIMPMRL 366


>gi|212632926|ref|YP_002309451.1| DNA polymerase III subunit beta [Shewanella piezotolerans WP3]
 gi|212554410|gb|ACJ26864.1| DNA polymerase III, beta subunit [Shewanella piezotolerans WP3]
          Length = 366

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 122/389 (31%), Positives = 214/389 (55%), Gaps = 27/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK +++R  +L+ L      +ER++ +P+  ++L++ +   L++  +  E+E+ G +   
Sbjct: 1   MKFSIDRDALLKPLQLVSGAVERRHNLPILANLLVEVSAHSLKLTGTDLEVELVGEVLLE 60

Query: 61  VDVC-GSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESEF 118
            +V  G  TV A    DIV+ L D  ++    +EN L     +  G S F L + P  E+
Sbjct: 61  GEVFEGRTTVPAKKFLDIVKSLPDQVELKIEQQENRL----LLRSGRSRFTLATLPAEEY 116

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P+ +  E    F L    +K+L++ T F+MA +++RYYLNG+      E   L A+ATDG
Sbjct: 117 PNVEAFEAELEFTLKQGTMKSLIDATQFSMANQDVRYYLNGLLLET--EGNVLRAIATDG 174

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA++   I A + +   +IVPRK V E++R     +  V +++ ++ I     +   +
Sbjct: 175 HRLALSHRMIEASLPE-KQVIVPRKGVLELMRSFEGDELDVTIAIGDNAIRATTATAVFT 233

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +L+DG FP+Y+ V+P   DK +  +   L+QA+ R SI+S+ + + V++ L ++ + +T
Sbjct: 234 SKLVDGRFPDYRRVLPKGGDKIVIASRQQLKQALLRASILSNEKFRGVRVQLENNLIKIT 293

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
            +NP+  +A E ++V Y   P++I FN  YLL++++N+ S     D+V   L   NSS  
Sbjct: 294 ANNPEQEEAEEILDVEYENTPLEIGFNVSYLLDVLNNLPS-----DDVRITLIDGNSSAL 348

Query: 359 IRGKDKDSKNNKDNKV--NAFYVLMPMRI 385
           I           DN V  ++ YV+MPMR+
Sbjct: 349 I-----------DNHVEQDSMYVVMPMRL 366


>gi|288939766|ref|YP_003442006.1| DNA polymerase III subunit beta [Allochromatium vinosum DSM 180]
 gi|288895138|gb|ADC60974.1| DNA polymerase III, beta subunit [Allochromatium vinosum DSM 180]
          Length = 366

 Score =  200 bits (509), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 121/387 (31%), Positives = 206/387 (53%), Gaps = 23/387 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+    R  +L  L     ++ER+ T+P+  ++L+ A  G + +  +  E+E+  +  A 
Sbjct: 1   MEFVANREIVLPALNKVIGVVERRQTLPILGNLLVVARAGRVTLTGTDLEVEVKTSFEAE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           +   G  T+ A  L DI R L +GA+I    ++E      ++ G   F L   P ++FP+
Sbjct: 61  IQQEGETTIPARKLVDICRNLSEGAEIRLRVKDE---RCVVTSGRGRFTLGLLPAADFPT 117

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
              EE  + F++  S LK L+++T FAMA +++RYYLNG+   ++     L AVATDGHR
Sbjct: 118 MDLEEGGFDFQIQESQLKRLLDKTAFAMAQQDVRYYLNGLLLELHAT--VLIAVATDGHR 175

Query: 181 LA--VAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           LA  V  +D+     +   +IVP K V E+ R L S D  + + LSE  + + + +++M+
Sbjct: 176 LAKFVTPLDLTLDTER--QVIVPNKTVMELKRQLGSSDDPISIRLSERSLRVVVGAMTMT 233

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +L+DG +P Y+ VIP  + +   V    L++A+ R SI+S+ + + V+LS     L + 
Sbjct: 234 SKLVDGRYPEYERVIPGHSGRTATVEKDALKRALSRTSILSNEKYRGVRLSFDPGTLKLL 293

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
             NP+  +A E + + Y+  P+ I FN  YL++++  I  DE     V+     +N S  
Sbjct: 294 AHNPEQEEAEEEIELEYDGEPISIGFNVAYLMDVLGVI--DETA---VIIHFQDANGSSI 348

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            RG   +S+          +V+MPMR+
Sbjct: 349 WRGVGGESET---------FVVMPMRL 366


>gi|33151999|ref|NP_873352.1| DNA polymerase III subunit beta [Haemophilus ducreyi 35000HP]
 gi|33148221|gb|AAP95741.1| DNA polymerase III beta chain [Haemophilus ducreyi 35000HP]
          Length = 367

 Score =  200 bits (509), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 124/387 (32%), Positives = 212/387 (54%), Gaps = 22/387 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEIT--GAIP 58
           M++T+ R  +L+ L   C ++  + T+PV  ++LL  N   L +  +  E+E+T    + 
Sbjct: 1   MQLTITREQLLKPLQQVCGVLSSRPTLPVINNILLDINGSRLSLTGTDLEVELTTQAELE 60

Query: 59  ASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEF 118
            +VD  G  T+ A    DI R L + + IS   E +      I    S F L + P S++
Sbjct: 61  QAVDFSGKFTLPAKKWLDICRSLPENSLISIQFEQDRAL---IRADRSKFNLATLPASDY 117

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P+  + +    F +  S L  L++ T F+MA ++ RY+LNG+ F      L+   VATDG
Sbjct: 118 PNLMDWKPEVDFSMEQSTLSRLIDATQFSMANQDARYFLNGMKFETEGNLLR--TVATDG 175

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLAV  + +  ++    S+IVPRKAV E+ RILS     V++ +  + + +++  +  +
Sbjct: 176 HRLAVCTMALSQELTTH-SVIVPRKAVLELSRILSMTADPVRLEIGTNNLRISMNGVVFT 234

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y+ V+P + D+ L      L++A+ R +I+S+ +   V+L+LS + L +T
Sbjct: 235 SKLIDGRFPDYRRVLPRNADRILEAETEMLKRALMRAAILSNEKFHGVRLALSENMLKIT 294

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
            +NP+  +A E ++V Y    M+I FN  YLL++++ +       + V F L  ++SS  
Sbjct: 295 ANNPEQEEAEEIIDVAYQNTAMEIGFNVSYLLDVLNTLKC-----ERVRFNLVDASSSCL 349

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           I    +D +N+      A YV+MPMR+
Sbjct: 350 I----EDCENS-----TAEYVIMPMRL 367


>gi|169794208|ref|YP_001712001.1| DNA polymerase III, beta chain [Acinetobacter baumannii AYE]
 gi|184156324|ref|YP_001844663.1| DNA polymerase sliding clamp subunit [Acinetobacter baumannii
           ACICU]
 gi|213155389|ref|YP_002317434.1| DNA polymerase III, beta subunit [Acinetobacter baumannii AB0057]
 gi|215481763|ref|YP_002323945.1| DNA polymerase III, beta subunit [Acinetobacter baumannii
           AB307-0294]
 gi|239503908|ref|ZP_04663218.1| DNA polymerase III, beta subunit [Acinetobacter baumannii AB900]
 gi|260558094|ref|ZP_05830305.1| DNA polymerase III, beta subunit [Acinetobacter baumannii ATCC
           19606]
 gi|301345944|ref|ZP_07226685.1| DNA polymerase III, beta subunit [Acinetobacter baumannii AB056]
 gi|301512868|ref|ZP_07238105.1| DNA polymerase III, beta subunit [Acinetobacter baumannii AB058]
 gi|301594681|ref|ZP_07239689.1| DNA polymerase III, beta subunit [Acinetobacter baumannii AB059]
 gi|332854714|ref|ZP_08435501.1| DNA polymerase III, beta subunit [Acinetobacter baumannii 6013150]
 gi|332865594|ref|ZP_08436434.1| DNA polymerase III, beta subunit [Acinetobacter baumannii 6013113]
 gi|332873308|ref|ZP_08441263.1| DNA polymerase III, beta subunit [Acinetobacter baumannii 6014059]
 gi|169147135|emb|CAM84994.1| DNA polymerase III, beta chain [Acinetobacter baumannii AYE]
 gi|183207918|gb|ACC55316.1| DNA polymerase sliding clamp subunit [Acinetobacter baumannii
           ACICU]
 gi|193075922|gb|ABO10499.2| DNA polymerase III [Acinetobacter baumannii ATCC 17978]
 gi|213054549|gb|ACJ39451.1| DNA polymerase III, beta subunit [Acinetobacter baumannii AB0057]
 gi|213987621|gb|ACJ57920.1| DNA polymerase III, beta subunit [Acinetobacter baumannii
           AB307-0294]
 gi|260408448|gb|EEX01755.1| DNA polymerase III, beta subunit [Acinetobacter baumannii ATCC
           19606]
 gi|322506193|gb|ADX01647.1| DNA polymerase III, beta chain [Acinetobacter baumannii 1656-2]
 gi|332727871|gb|EGJ59273.1| DNA polymerase III, beta subunit [Acinetobacter baumannii 6013150]
 gi|332735246|gb|EGJ66323.1| DNA polymerase III, beta subunit [Acinetobacter baumannii 6013113]
 gi|332738514|gb|EGJ69386.1| DNA polymerase III, beta subunit [Acinetobacter baumannii 6014059]
          Length = 382

 Score =  200 bits (509), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 120/401 (29%), Positives = 210/401 (52%), Gaps = 35/401 (8%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++ + +  +L +L H    +ER++T+ +  +V +Q N   L I  S  E+E+  +   S
Sbjct: 1   MRLKIAKESLLNVLSHVVGAVERRHTLNILSNVKIQTNAQALTITGSDLEVELVASTALS 60

Query: 61  VDVC---GSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPES 116
              C   G  TV A  L +I + L   A I     E++      +  G+S F L + P  
Sbjct: 61  EGACLEAGETTVPARKLMEICKSLPTAALIDLQITEDQ---RCILKSGNSRFVLGTLPAE 117

Query: 117 EFPS-TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVA 175
           ++P  T E       ++    LK L E+T FAMA +++R+YL G    I+E  L+  AV 
Sbjct: 118 DYPLLTTENSQGTQVQVTQRELKRLFEKTAFAMAVQDVRFYLTGTLLEIDENQLR--AVT 175

Query: 176 TDGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESL 235
           TDGHRLA+ E+   +  +++   IVPRKAVGE+ R+LS +D  + + +    +++ I + 
Sbjct: 176 TDGHRLALCEILASSTSSQLVQAIVPRKAVGELQRLLSIEDEQLTLLIGRELLNVTINTP 235

Query: 236 S-----------MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQ 284
           S            + +LIDG+FP+Y+ VIP   DK + +     +Q++ RV+I+S+ +++
Sbjct: 236 SRDKEQGDITVRFTTKLIDGKFPDYRRVIPRGGDKHVLIGHDVFKQSLQRVAILSNEKLR 295

Query: 285 AVKLSLSSDKLCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDD 344
            V L+ + D L +  +NP+  +AIE + + Y   P+++ FN +YLL+++  +       D
Sbjct: 296 GVFLNFNQDSLQLRANNPEQDEAIEDLAIQYQSAPLEMSFNAQYLLDVLGVLDG-----D 350

Query: 345 EVVFRLDSSNSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +V   +  +N SV ++      +          YV+MPMR+
Sbjct: 351 DVNMSMTEANQSVLVQDPAHPDQT---------YVVMPMRV 382


>gi|325275333|ref|ZP_08141284.1| DNA polymerase III subunit beta [Pseudomonas sp. TJI-51]
 gi|324099524|gb|EGB97419.1| DNA polymerase III subunit beta [Pseudomonas sp. TJI-51]
          Length = 367

 Score =  200 bits (509), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 121/389 (31%), Positives = 212/389 (54%), Gaps = 26/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAI--- 57
           M  T++R  +L+ L     ++ER+ T+PV  +VLL      L +  +  E+E+ G +   
Sbjct: 1   MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVQGQQLSLTGTDLEVELVGRVQLE 60

Query: 58  -PASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPES 116
            PA     G ITV A  L DI + L + A I    + +   ++ +  G S F L + P +
Sbjct: 61  EPAE---PGEITVPARKLMDICKSLPNDALIDIKVDEQ---KLLLKAGRSRFTLSTLPAN 114

Query: 117 EFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVAT 176
           +FP+ +E     +  L  S L+ L+ERT FAMA +++RYYLNG+   ++   L+  AV+T
Sbjct: 115 DFPTVEEGPGSLTCNLEQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVSRNTLR--AVST 172

Query: 177 DGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLS 236
           DGHRLA+  +    +      +IVPRK + E+ R+L+  +  V + L +  I       +
Sbjct: 173 DGHRLALCSMTAPIEQDDRHQVIVPRKGILELARLLTDPEGMVSIVLGQHHIRATTGEFT 232

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
            + +L+DG+FP+Y+ V+P   DK +  +   LR+A  R SI+S+ + + ++L L++ +L 
Sbjct: 233 FTSKLVDGKFPDYERVLPKGGDKVVVGDRQALREAFSRTSILSNEKYRGIRLQLAAGQLK 292

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           +  +NP+  +A E ++V Y+   ++I FN  YLL+++  +++     ++V   L  SNSS
Sbjct: 293 IQANNPEQEEAEEEISVDYDGSSLEIGFNVSYLLDVLGVMTT-----EQVRLILSDSNSS 347

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             ++    D         ++ YV+MPMR+
Sbjct: 348 ALLQEAGND---------DSSYVVMPMRL 367


>gi|328675184|gb|AEB27859.1| DNA polymerase III beta subunit [Francisella cf. novicida 3523]
          Length = 367

 Score =  200 bits (508), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 125/389 (32%), Positives = 222/389 (57%), Gaps = 26/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M   + R D+L+ L     +   K+T+P+   +L   ++  L+I AS  + EI+  I  S
Sbjct: 1   MNFVLNRDDLLKPLQSMLSVANSKSTMPLLSCILFDIDNNNLKITASDLDTEISCNIAVS 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP- 119
            +    + ++A  +Y+IVR L + + I F + NE   +V I   +S F L S     +P 
Sbjct: 61  CNTSIKLALNADKIYNIVRSLNENSMIDF-RVNE--NKVTIVSNNSTFNLISLNADNYPL 117

Query: 120 --STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATD 177
             S   E+   SF+L+     +++ +  F+MA ++ RY+LNG+F+ IN   L+  AV+TD
Sbjct: 118 IDSNINEQA--SFDLSQQDFHHIISKVDFSMANDDTRYFLNGMFWEINANLLR--AVSTD 173

Query: 178 GHRLAVAEVDIVAQIAKMPS-IIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLS 236
           GHR+++ E  I +++    S  I+P+KA+ E+ +I+   + ++K+ L ++ +     + +
Sbjct: 174 GHRMSITEAIIDSKVLDSASQSIIPKKAILELKKIVGKTEENIKICLGKNYLKAIFGNYA 233

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
              +LIDG +P+YQ VIP +N K L V+    + ++ R SI+++ + + V+L++S ++L 
Sbjct: 234 FISKLIDGRYPDYQKVIPKNNTKLLAVDKQFFKNSLLRTSILANDKYKGVRLNISQNQLL 293

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           ++ +NPD  KA + + V YN+  M+ICFNYKYLL+II N+ S+E     +   LD+ N S
Sbjct: 294 LSANNPDNEKAEDKIEVQYNDQAMEICFNYKYLLDII-NVLSEET----MTIYLDNPNMS 348

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             +          KD K N+ +++MPM+I
Sbjct: 349 ALV----------KDEKDNSLFIIMPMKI 367


>gi|169632031|ref|YP_001705767.1| DNA polymerase III, beta chain [Acinetobacter baumannii SDF]
 gi|169150823|emb|CAO99423.1| DNA polymerase III, beta chain [Acinetobacter baumannii]
 gi|323516069|gb|ADX90450.1| DNA polymerase sliding clamp subunit [Acinetobacter baumannii
           TCDC-AB0715]
          Length = 382

 Score =  200 bits (508), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 120/401 (29%), Positives = 210/401 (52%), Gaps = 35/401 (8%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++ + +  +L +L H    +ER++T+ +  +V +Q N   L I  S  E+E+  +   S
Sbjct: 1   MRLKIAKESLLNVLSHVVGAVERRHTLNILSNVKIQTNAQALTITGSDLEVELVASTALS 60

Query: 61  VDVC---GSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPES 116
              C   G  TV A  L +I + L   A I     E++      +  G+S F L + P  
Sbjct: 61  EGACLEAGETTVPARKLMEICKSLPTAALIDLQITEDQ---RCILKSGNSRFVLGTLPAE 117

Query: 117 EFPS-TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVA 175
           ++P  T E       ++    LK L E+T FAMA +++R+YL G    I+E  L+  AV 
Sbjct: 118 DYPLLTTENSQGTQVQVTQRELKRLFEKTAFAMAVQDVRFYLTGTLLEIDENQLR--AVT 175

Query: 176 TDGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESL 235
           TDGHRLA+ E+   +  +++   IVPRKAVGE+ R+LS +D  + + +    +++ I + 
Sbjct: 176 TDGHRLALCEILASSTSSQLVQAIVPRKAVGELQRLLSIEDEQLTLLIGRELLNVTINTP 235

Query: 236 S-----------MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQ 284
           S            + +LIDG+FP+Y+ VIP   DK + +     +Q++ RV+I+S+ +++
Sbjct: 236 SRDKEQGDITVRFTTKLIDGKFPDYRRVIPRGGDKHVLIGHDVFKQSLQRVAILSNEKLR 295

Query: 285 AVKLSLSSDKLCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDD 344
            V L+ + D L +  +NP+  +AIE + + Y   P+++ FN +YLL+++  +       D
Sbjct: 296 GVFLNFNQDSLQLRANNPEQDEAIEDLAIQYQNAPLEMSFNAQYLLDVLGVLDG-----D 350

Query: 345 EVVFRLDSSNSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +V   +  +N SV ++      +          YV+MPMR+
Sbjct: 351 DVNMSMTEANQSVLVQDPAHPDQT---------YVVMPMRV 382


>gi|260553771|ref|ZP_05826041.1| DNA polymerase subunit III [Acinetobacter sp. RUH2624]
 gi|260405075|gb|EEW98575.1| DNA polymerase subunit III [Acinetobacter sp. RUH2624]
          Length = 382

 Score =  200 bits (508), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 120/401 (29%), Positives = 209/401 (52%), Gaps = 35/401 (8%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++ + +  +L +L H    +ER++T+ +  +V +Q N   L I  S  E+E+  +   S
Sbjct: 1   MRLKIAKESLLNVLSHVVGAVERRHTLNILSNVKIQTNGQALTITGSDLEVELVASTALS 60

Query: 61  VDVC---GSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPES 116
              C   G  TV A  L DI + L   A I     E++      +  G+S F L + P  
Sbjct: 61  EGACLEAGETTVPARKLMDICKSLPTAALIDLQITEDQ---RCILKSGNSRFVLGTLPAE 117

Query: 117 EFPS-TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVA 175
           ++P    E       ++    LK L E+T FAMA +++R+YL G    I+E  L+  AV 
Sbjct: 118 DYPLLNTENSQGTQVQVTQRELKRLFEKTAFAMAVQDVRFYLTGTLLEIDENQLR--AVT 175

Query: 176 TDGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESL 235
           TDGHRLA+ E+   +  +++   IVPRKAVGE+ R+LS +D  + + +    +++ I + 
Sbjct: 176 TDGHRLALCEILASSSSSQLVQAIVPRKAVGELQRLLSIEDEQLTLLIGRELLNVTINTP 235

Query: 236 S-----------MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQ 284
           S            + +LIDG+FP+Y+ VIP   DK + +     +Q++ RV+I+S+ +++
Sbjct: 236 SRDKEQGDITVRFTTKLIDGKFPDYRRVIPRGGDKHVLIGHDVFKQSLQRVAILSNEKLR 295

Query: 285 AVKLSLSSDKLCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDD 344
            V L+ + D L +  +NP+  +AIE + + Y   P+++ FN +YLL+++  +       D
Sbjct: 296 GVFLNFNQDSLQLRANNPEQDEAIEDLAIQYQNTPLEMSFNAQYLLDVLGVLDG-----D 350

Query: 345 EVVFRLDSSNSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +V   +  +N SV ++      +          YV+MPMR+
Sbjct: 351 DVNMSMTEANQSVLVQDPAHPDQT---------YVVMPMRV 382


>gi|268628305|gb|ACZ13551.1| DNA polymerase III beta chain [Xenorhabdus bovienii]
          Length = 276

 Score =  200 bits (508), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 104/269 (38%), Positives = 164/269 (60%), Gaps = 8/269 (2%)

Query: 65  GSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTKE 123
           G+ T+ A   +DI R L DGA+IS     EL G  + +  G S F L + P S+FP+  +
Sbjct: 15  GATTIPARKFFDIWRGLPDGAEISV----ELDGDRILVRSGRSRFSLSTLPASDFPNLDD 70

Query: 124 EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAV 183
            +    F L  + LK L+E T F+MA +++RYYLNG+ F   EE+L+   VATDGHRLAV
Sbjct: 71  WQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEEEELR--TVATDGHRLAV 128

Query: 184 AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID 243
             ++I  Q     S+IVPRK V E++R+L   DS +++ +  + I  ++     + +L+D
Sbjct: 129 CSMNI-GQNLPSHSVIVPRKGVIELMRLLDGGDSPLQLQIGSNNIRAHVGDFVFTSKLVD 187

Query: 244 GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPD 303
           G FP+Y+ V+P + DK L  NC  L+QA  R +I+S+ + + V++ LS ++L +T +NP+
Sbjct: 188 GRFPDYRRVLPKNPDKTLEANCDVLKQAFSRAAILSNEKFRGVRIYLSQNQLRITANNPE 247

Query: 304 MGKAIESMNVYYNECPMDICFNYKYLLEI 332
             +A E ++V Y    M+I FN  Y+L++
Sbjct: 248 QEEAEEIVDVSYQGTEMEIGFNVSYVLDV 276


>gi|268628303|gb|ACZ13550.1| DNA polymerase III beta chain [Xenorhabdus bovienii]
 gi|268628307|gb|ACZ13552.1| DNA polymerase III beta chain [Xenorhabdus bovienii]
          Length = 276

 Score =  199 bits (507), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 104/269 (38%), Positives = 164/269 (60%), Gaps = 8/269 (2%)

Query: 65  GSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTKE 123
           G+ T+ A   +DI R L DGA+IS     EL G  + +  G S F L + P S+FP+  +
Sbjct: 15  GATTIPARKFFDIWRGLPDGAEISV----ELDGDRILVRSGRSRFSLSTLPASDFPNLDD 70

Query: 124 EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAV 183
            +    F L  + LK L+E T F+MA +++RYYLNG+ F   EE+L+   VATDGHRLAV
Sbjct: 71  WQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEEEELR--TVATDGHRLAV 128

Query: 184 AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID 243
             ++I  Q     S+IVPRK V E++R+L   DS +++ +  + I  ++     + +L+D
Sbjct: 129 CSMNI-GQNLPSHSVIVPRKGVIELMRLLDGGDSPLQLQIGSNNIRAHVGDFVFTSKLVD 187

Query: 244 GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPD 303
           G FP+Y+ V+P + DK L  NC  L+QA  R +I+S+ + + V++ LS ++L +T +NP+
Sbjct: 188 GRFPDYRRVLPKNPDKTLEANCDVLKQAFSRAAILSNEKFRGVRIYLSENQLRITANNPE 247

Query: 304 MGKAIESMNVYYNECPMDICFNYKYLLEI 332
             +A E ++V Y    M+I FN  Y+L++
Sbjct: 248 QEEAEEIVDVSYQGTEMEIGFNVSYVLDV 276


>gi|268628309|gb|ACZ13553.1| DNA polymerase III beta chain [Xenorhabdus bovienii]
          Length = 276

 Score =  199 bits (506), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 104/269 (38%), Positives = 164/269 (60%), Gaps = 8/269 (2%)

Query: 65  GSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTKE 123
           G+ T+ A   +DI R L DGA+IS     EL G  + +  G S F L + P S+FP+  +
Sbjct: 15  GATTIPARKFFDIWRGLPDGAEISV----ELDGDRILVRSGRSRFSLSTLPASDFPNLDD 70

Query: 124 EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAV 183
            +    F L  + LK L+E T F+MA +++RYYLNG+ F   EE+L+   VATDGHRLAV
Sbjct: 71  WQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEEEELR--TVATDGHRLAV 128

Query: 184 AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID 243
             ++I  Q     S+IVPRK V E++R+L   DS +++ +  + I  ++     + +L+D
Sbjct: 129 CSMNI-GQNLPSHSVIVPRKGVIELMRLLDGGDSPLQLQIGSNNIRAHVGDFIFTSKLVD 187

Query: 244 GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPD 303
           G FP+Y+ V+P + DK L  NC  L+QA  R +I+S+ + + V++ LS ++L +T +NP+
Sbjct: 188 GRFPDYRRVLPKNPDKTLEANCDVLKQAFSRAAILSNEKFRGVRIYLSENQLRITANNPE 247

Query: 304 MGKAIESMNVYYNECPMDICFNYKYLLEI 332
             +A E ++V Y    M+I FN  Y+L++
Sbjct: 248 QEEAEEIVDVSYQGTEMEIGFNVSYVLDV 276


>gi|303251823|ref|ZP_07337994.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307249124|ref|ZP_07531131.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|302649253|gb|EFL79438.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|306854412|gb|EFM86608.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
          Length = 367

 Score =  199 bits (506), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 120/388 (30%), Positives = 214/388 (55%), Gaps = 24/388 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEIT--GAIP 58
           M+ T+ R  +L+ L   C ++  + T+PV  ++LL+     L +  +  E+E+T    + 
Sbjct: 1   MQFTITREQLLKPLQQVCGVLSSRPTLPVINNILLEIEGDRLSLTGTDLEVELTTVATLE 60

Query: 59  ASVDVCGSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESE 117
            +VD  G  T+ A    DI R L + + IS  F+E+       +    S F L + P S+
Sbjct: 61  QAVDFAGKFTIPAKKFLDICRSLPEDSSISVQFEEDR----ALVRAARSKFNLATLPASD 116

Query: 118 FPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATD 177
           +P+  + +    F +  S L  L++ T F+MA +++RY+LNG+ F      L+   VATD
Sbjct: 117 YPNLMDWKPEVDFSIEQSTLARLIDATQFSMANQDVRYFLNGMKFETEGNLLR--TVATD 174

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLAV  + +  ++    S+IVPRKAV E+ R+++  D +V++ +  S + +++  +  
Sbjct: 175 GHRLAVCTMALNQELLTH-SVIVPRKAVLELSRLVAVSDETVRLEIGTSNLRVSMNGVVF 233

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +LIDG FP+Y+ V+P + D+ L      L++A+ R +I+S+ + + V+L+LS + L +
Sbjct: 234 TSKLIDGRFPDYRRVLPRNADRILEAETEVLKRALMRAAILSNEKFRGVRLALSENLLKI 293

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           T +NP+  +A E ++V Y    M++ FN  YLL++++ +       + V F L  ++SS 
Sbjct: 294 TANNPEQEEAEEIIDVAYQSPEMEVGFNVSYLLDVLNTLKC-----ERVRFNLVDASSSC 348

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            I   D  +         A YV+MPMR+
Sbjct: 349 LIEDCDNST---------AEYVIMPMRL 367


>gi|26986756|ref|NP_742181.1| DNA polymerase III subunit beta [Pseudomonas putida KT2440]
 gi|148545261|ref|YP_001265363.1| DNA polymerase III subunit beta [Pseudomonas putida F1]
 gi|60392201|sp|P0A120|DPO3B_PSEPK RecName: Full=DNA polymerase III subunit beta
 gi|60392202|sp|P0A121|DPO3B_PSEPU RecName: Full=DNA polymerase III subunit beta
 gi|24981347|gb|AAN65645.1|AE016191_2 DNA polymerase III, beta subunit [Pseudomonas putida KT2440]
 gi|45691|emb|CAA32894.1| unnamed protein product [Pseudomonas putida]
 gi|148509319|gb|ABQ76179.1| DNA polymerase III, beta subunit [Pseudomonas putida F1]
 gi|313496419|gb|ADR57785.1| DnaN [Pseudomonas putida BIRD-1]
          Length = 367

 Score =  199 bits (506), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 120/389 (30%), Positives = 211/389 (54%), Gaps = 26/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAI--- 57
           M  T++R  +L+ L     ++ER+ T+PV  +VLL      L +  +  E+E+ G +   
Sbjct: 1   MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVQGQQLSLTGTDLEVELVGRVQLE 60

Query: 58  -PASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPES 116
            PA     G ITV A  L DI + L + A I    + +   ++ +  G S F L + P +
Sbjct: 61  EPAE---PGEITVPARKLMDICKSLPNDALIDIKVDEQ---KLLVKAGRSRFTLSTLPAN 114

Query: 117 EFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVAT 176
           +FP+ +E     +  L  S L+ L+ERT FAMA +++RYYLNG+   ++   L+  AV+T
Sbjct: 115 DFPTVEEGPGSLTCNLEQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVSRNTLR--AVST 172

Query: 177 DGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLS 236
           DGHRLA+  +    +      +IVPRK + E+ R+L+  +  V + L +  I       +
Sbjct: 173 DGHRLALCSMSAPIEQEDRHQVIVPRKGILELARLLTDPEGMVSIVLGQHHIRATTGEFT 232

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
            + +L+DG+FP+Y+ V+P   DK +  +   LR+A  R +I+S+ + + ++L L++ +L 
Sbjct: 233 FTSKLVDGKFPDYERVLPKGGDKLVVGDRQALREAFSRTAILSNEKYRGIRLQLAAGQLK 292

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           +  +NP+  +A E ++V Y    ++I FN  YLL+++  +++     ++V   L  SNSS
Sbjct: 293 IQANNPEQEEAEEEISVDYEGSSLEIGFNVSYLLDVLGVMTT-----EQVRLILSDSNSS 347

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             ++    D         ++ YV+MPMR+
Sbjct: 348 ALLQEAGND---------DSSYVVMPMRL 367


>gi|303250481|ref|ZP_07336678.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307251523|ref|ZP_07533430.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307256023|ref|ZP_07537811.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|302650469|gb|EFL80628.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306860987|gb|EFM92993.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306865445|gb|EFM97340.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
          Length = 367

 Score =  199 bits (505), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 121/388 (31%), Positives = 214/388 (55%), Gaps = 24/388 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEIT--GAIP 58
           M+ T+ R  +L+ L   C ++  + T+PV  ++LL+     L + A+  E+E+T    + 
Sbjct: 1   MQFTITREQLLKPLQQVCGVLSSRPTLPVINNILLEIEGDRLSLTATDLEVELTTVATLE 60

Query: 59  ASVDVCGSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESE 117
            +VD  G  T+ A    DI R L + + IS  F+E+       +    S F L + P S+
Sbjct: 61  QAVDFAGKFTIPAKKFLDICRSLPEDSSISVQFEEDR----ALVRAARSKFNLATLPASD 116

Query: 118 FPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATD 177
           +P+  + +    F +  S L  L++ T F+MA ++ RY+LNG+ F      L+   VATD
Sbjct: 117 YPNLMDWKPEVDFSIEQSTLARLIDATQFSMANQDARYFLNGMKFETEGNLLR--TVATD 174

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLAV  + +  ++    S+IVPRKAV E+ R+++  D +V++ +  S + +++  +  
Sbjct: 175 GHRLAVCTMALNQELLTH-SVIVPRKAVLELSRLVAVSDETVRLEIGTSNLRVSMNGVVF 233

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +LIDG FP+Y+ V+P + D+ L      L++A+ R +I+S+ + + V+L+LS + L +
Sbjct: 234 TSKLIDGRFPDYRRVLPRNADRILEAETEVLKRALMRAAILSNEKFRGVRLALSENLLKI 293

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           T +NP+  +A E ++V Y    M++ FN  YLL++++ +       + V F L  ++SS 
Sbjct: 294 TANNPEQEEAEEIIDVAYQSPEMEVGFNVSYLLDVLNTLKC-----ERVRFNLVDASSSC 348

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            I   D  +         A YV+MPMR+
Sbjct: 349 LIEDCDNST---------AEYVIMPMRL 367


>gi|293611383|ref|ZP_06693679.1| DNA polymerase III [Acinetobacter sp. SH024]
 gi|292826255|gb|EFF84624.1| DNA polymerase III [Acinetobacter sp. SH024]
          Length = 382

 Score =  199 bits (505), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 119/401 (29%), Positives = 211/401 (52%), Gaps = 35/401 (8%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++ + +  +L +L H    +ER++T+ +  +V +Q N   L I  S  E+E+  +   +
Sbjct: 1   MRLKIAKESLLNVLSHVVGAVERRHTLNILSNVKIQTNAQALTITGSDLEVELVASTVLT 60

Query: 61  VDVC---GSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPES 116
              C   G  TV A  L +I + L   A I     E++      +  G+S F L + P  
Sbjct: 61  EGACIEAGETTVPARKLMEICKSLPTAALIDLQITEDQ---RCILKSGNSRFVLGTLPAE 117

Query: 117 EFPS-TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVA 175
           ++P  T E       ++    LK L E+T FAMA +++R+YL G    I+E  L+  AV 
Sbjct: 118 DYPLLTTENSQGTQVQVTQRELKRLFEKTAFAMAVQDVRFYLTGTLLEIDENQLR--AVT 175

Query: 176 TDGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESL 235
           TDGHRLA+ E+   +  +++   IVPRKAVGE+ R+LS +D  + + +    +++ I + 
Sbjct: 176 TDGHRLALCEITASSTSSQLVQAIVPRKAVGELQRLLSIEDEQLTLLIGRELLNVTINTP 235

Query: 236 S-----------MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQ 284
           S            + +LIDG+FP+Y+ VIP   DK + ++    +Q++ RV+I+S+ +++
Sbjct: 236 SRDKEQGDITVRFTTKLIDGKFPDYRRVIPRGGDKHVLISHDVFKQSLQRVAILSNEKLR 295

Query: 285 AVKLSLSSDKLCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDD 344
            V L+ + D L +  +NP+  +AIE + + Y   P+++ FN +YLL+++  +       D
Sbjct: 296 GVFLNFNQDSLQLRANNPEQDEAIEDLAIQYQNIPLEMSFNAQYLLDVLGVLDG-----D 350

Query: 345 EVVFRLDSSNSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +V   +  +N SV ++      +          YV+MPMR+
Sbjct: 351 DVNMSMTEANQSVLVQDPAHPDQT---------YVVMPMRV 382


>gi|167031025|ref|YP_001666256.1| DNA polymerase III subunit beta [Pseudomonas putida GB-1]
 gi|166857513|gb|ABY95920.1| DNA polymerase III, beta subunit [Pseudomonas putida GB-1]
          Length = 367

 Score =  199 bits (505), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 120/389 (30%), Positives = 211/389 (54%), Gaps = 26/389 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAI--- 57
           M  T++R  +L+ L     ++ER+ T+PV  +VLL      L +  +  E+E+ G +   
Sbjct: 1   MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVQGQQLSLTGTDLEVELVGRVQLE 60

Query: 58  -PASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPES 116
            PA     G ITV A  L DI + L + A I    + +   ++ +  G S F L + P +
Sbjct: 61  EPAE---PGEITVPARKLMDICKSLPNDALIDIKVDEQ---KLLVKAGRSRFTLSTLPAN 114

Query: 117 EFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVAT 176
           +FP+ +E     +  L  S L+ L+ERT FAMA +++RYYLNG+   ++   L+  AV+T
Sbjct: 115 DFPTAEEGPGSLTCNLEQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVSRNTLR--AVST 172

Query: 177 DGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLS 236
           DGHRLA+  +    +      +IVPRK + E+ R+L+  +  V + L +  I       +
Sbjct: 173 DGHRLALCSMTAPIEQDDRHQVIVPRKGILELARLLTDPEGMVSIVLGQHHIRATTGEFT 232

Query: 237 MSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLC 296
            + +L+DG+FP+Y+ V+P   DK +  +   LR+A  R +I+S+ + + ++L L++ +L 
Sbjct: 233 FTSKLVDGKFPDYERVLPKGGDKLVVGDRQALREAFSRTAILSNEKYRGIRLQLAAGQLK 292

Query: 297 MTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSS 356
           +  +NP+  +A E ++V Y    ++I FN  YLL+++  +++     ++V   L  SNSS
Sbjct: 293 IQANNPEQEEAEEEISVDYKGSSLEIGFNVSYLLDVLGVMTT-----EQVRLILSDSNSS 347

Query: 357 VFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             ++    D         ++ YV+MPMR+
Sbjct: 348 ALLQEAGND---------DSSYVVMPMRL 367


>gi|113460283|ref|YP_718342.1| DNA polymerase III subunit beta [Haemophilus somnus 129PT]
 gi|170718298|ref|YP_001783357.1| DNA polymerase III subunit beta [Haemophilus somnus 2336]
 gi|112822326|gb|ABI24415.1| DNA polymerase III, beta subunit [Haemophilus somnus 129PT]
 gi|168826427|gb|ACA31798.1| DNA polymerase III, beta subunit [Haemophilus somnus 2336]
          Length = 366

 Score =  199 bits (505), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 123/388 (31%), Positives = 210/388 (54%), Gaps = 25/388 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGA---I 57
           M+  V R  +L+ L   C ++  +   P+  +VLLQ    +L I  +  E+E++     I
Sbjct: 1   MQFIVSREHLLKPLQQVCGVLSSRPNFPILNNVLLQIEGNVLRITGTDLEVELSTQAQLI 60

Query: 58  PASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESE 117
            AS D  GS T+ A    DI R   D A+I+   E E      +  G S F L + P  E
Sbjct: 61  QASQD--GSYTIPAKKFLDICRSFPDEAEITVIFEEERAL---VRSGRSKFNLTALPADE 115

Query: 118 FPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATD 177
           +P+  + +    F L  S L+ L+E T F+MA ++ RY+LNG+ F      L+   VATD
Sbjct: 116 YPNLADWQSEVDFYLPQSTLRRLIEATQFSMANQDARYFLNGMKFETEGNLLR--TVATD 173

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLAV  + +  Q     ++I+PRK + E++R+L + + +  V +  + + +++ S+  
Sbjct: 174 GHRLAVCTIPL-EQDLHTHAVILPRKGILELMRLLENSEHAAHVQIGTNNLRIDLGSIIF 232

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +LIDG FP+Y+ V+P +    +  N   L+QA  R++I+SS +++ V+L L+S++L +
Sbjct: 233 TSKLIDGRFPDYRRVLPRNATHIMEGNWELLKQAFARMAILSSDKVKTVRLQLTSNQLKI 292

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           T  NP+   A E ++V YN   M++ FN  Y+L++++ +   +V    + F    ++SS 
Sbjct: 293 TATNPEQEVAEEILDVIYNGADMEVGFNVSYILDVLNALKCQQV---RLCF--TDASSSC 347

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            +   D +S         A YV+MPMR+
Sbjct: 348 LLEDADDES---------AEYVVMPMRL 366


>gi|50083299|ref|YP_044809.1| DNA polymerase III beta [Acinetobacter sp. ADP1]
 gi|49529275|emb|CAG66987.1| DNA polymerase III, beta chain [Acinetobacter sp. ADP1]
          Length = 382

 Score =  198 bits (504), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 119/401 (29%), Positives = 210/401 (52%), Gaps = 35/401 (8%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++ + +  +L +L H    +ER++T+ +  +V +QAN   L I  S  E+E+  +   +
Sbjct: 1   MRLKIAKESLLNVLSHVVGAVERRHTLNILSNVKIQANAQALTITGSDLEVELVASTTLA 60

Query: 61  VDVC---GSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPES 116
              C   G  TV A  L DI + L   A I     E++      +  G+S F L + P  
Sbjct: 61  EGACIEAGETTVPARKLVDICKSLPSAALIDLQITEDQ---RCILKSGNSRFVLGTLPAE 117

Query: 117 EFPS-TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVA 175
           ++P  T E       ++    LK L E+T FAMA +++R+YL G    I++  L+  AV 
Sbjct: 118 DYPLLTTESSQGTQVQVTQRELKRLFEKTSFAMAVQDVRFYLTGTLLEIDQNQLR--AVT 175

Query: 176 TDGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIE-- 233
           TDGHRLA+ EV   +   +    IVPRKAVGE+ R+LS +D  + + +    +++ I   
Sbjct: 176 TDGHRLALCEVQASSTAMQAVQAIVPRKAVGELQRLLSIEDDQLSLLIGRELLNVTINIA 235

Query: 234 ---------SLSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQ 284
                    ++  + +LIDG+FP+Y+ VIP   DK +++     +Q++ RV+I+S+ +++
Sbjct: 236 NRDKEQHPITVRFTTKLIDGKFPDYRRVIPRGGDKHVQIAHDVFKQSLQRVAILSNEKLR 295

Query: 285 AVKLSLSSDKLCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDD 344
            V L+ + D L +  +NP+  +AIE + + Y +  +++ FN +YLL+++  +       D
Sbjct: 296 GVFLNFNPDVLQLRANNPEQDEAIEDIAIQYQDASLEMSFNAQYLLDVLSVLDG-----D 350

Query: 345 EVVFRLDSSNSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           +V   +  +N SV ++      +          YV+MPMR+
Sbjct: 351 DVSMSMTEANQSVLVQDAAHPDQT---------YVVMPMRV 382


>gi|268628293|gb|ACZ13545.1| DNA polymerase III beta chain [Xenorhabdus beddingii]
          Length = 276

 Score =  198 bits (504), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 103/269 (38%), Positives = 163/269 (60%), Gaps = 8/269 (2%)

Query: 65  GSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTKE 123
           G+ TV A   +DI R L DGA+IS     EL G  + +  G S F L + P S+FP+  +
Sbjct: 15  GATTVPARKFFDIWRGLPDGAEISV----ELDGDRILVRSGRSRFSLSTLPASDFPNLDD 70

Query: 124 EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAV 183
            +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGHRLAV
Sbjct: 71  WQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGHRLAV 128

Query: 184 AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID 243
             ++I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + +L+D
Sbjct: 129 CSMNI-GQTLPSHSVIVPRKGVIELMRLLDGGDNPLQLQIGSNNIRAHVGDFIFTSKLVD 187

Query: 244 GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPD 303
           G FP+Y+ V+P + DK L  NC  L+QA  R +I+S+ + + V++ LS ++L +T +NP+
Sbjct: 188 GRFPDYRRVLPKNPDKTLEANCDTLKQAFSRAAILSNEKFRGVRIYLSENQLRITANNPE 247

Query: 304 MGKAIESMNVYYNECPMDICFNYKYLLEI 332
             +A E ++V Y    M+I FN  Y+L++
Sbjct: 248 QEEAEEIVDVSYQGTEMEIGFNVSYVLDV 276


>gi|260912770|ref|ZP_05919256.1| DNA-directed DNA polymerase III beta subunit [Pasteurella dagmatis
           ATCC 43325]
 gi|260633148|gb|EEX51313.1| DNA-directed DNA polymerase III beta subunit [Pasteurella dagmatis
           ATCC 43325]
          Length = 366

 Score =  198 bits (504), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 125/386 (32%), Positives = 209/386 (54%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEI-TGAIPA 59
           M+  V R ++L+ L   C ++  +  IPV  +VLLQ N   L I  +  E+E+ T +   
Sbjct: 1   MQFIVSRENLLKPLQQVCGVLSSRPNIPVLNNVLLQINGDCLVITGTDLEVELSTQSALL 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
           S DV G+ T+ A    DI R L + A+IS   E +      +  G S F L + P  E+P
Sbjct: 61  STDVKGNFTIPAKKFLDICRSLPENAEISVSFEEDRAI---VKSGRSKFNLSTLPAEEYP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F +  S L+ L+E T F+MA ++ RY+LNG+ F      L+   VATDGH
Sbjct: 118 NLTDWQSEVDFTIEQSTLRRLIEATQFSMANQDARYFLNGMKFETEGNLLR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + +  Q  +  S+I+PRK V E++R+L + D   ++ +  + + + + ++  + 
Sbjct: 176 RLAVCTIAL-EQDLQTHSVILPRKGVLELVRLLENTDLPARLQIGTNNLRIELGNIIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +LIDG FP+Y+ V+P +  + L  +   L+QA  R +I+S+ R ++V+L LS ++L +T 
Sbjct: 235 KLIDGRFPDYRRVLPRNATRILEADWDVLKQAFVRAAILSNERFRSVRLQLSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
            NP+   A E ++V Y    M++ FN  Y+L++++ +         V  RL  ++SS  I
Sbjct: 295 TNPEQEVAEEIIDVSYIGEEMEVGFNVSYILDVLNALKC-----QRVRMRLTDASSSCLI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              +  S         A YV+MPMR+
Sbjct: 350 EDCEDAS---------AEYVIMPMRL 366


>gi|257464819|ref|ZP_05629190.1| DNA polymerase III subunit beta [Actinobacillus minor 202]
 gi|257450479|gb|EEV24522.1| DNA polymerase III subunit beta [Actinobacillus minor 202]
          Length = 367

 Score =  198 bits (504), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 123/387 (31%), Positives = 211/387 (54%), Gaps = 22/387 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEIT--GAIP 58
           M  T+ R  +L  L   C ++  + T+PV  ++LL+     L +  +  E+E+T    + 
Sbjct: 1   MLFTITREQLLRPLQQVCGVLASRPTLPVIGNLLLEVEGERLSMTGTDLEVELTTQAQLA 60

Query: 59  ASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEF 118
            +V+     T+ A    DI + L D + IS   E +      I  G S F L + P S++
Sbjct: 61  QAVNFSEKFTIPAKKFLDIAKSLPDDSVISIAFEADKAV---IKAGRSKFSLATLPASDY 117

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P+  +      F +  S L  L++ T F+MA ++ RY+LNG+ F      L+   VATDG
Sbjct: 118 PNLMDWTPEVDFSIEQSTLARLIDATQFSMANQDARYFLNGMKFETEGNLLR--TVATDG 175

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLAV  + +  ++A   S+IVPRKAV E+ R++S+    V++ +  S I +++  +  +
Sbjct: 176 HRLAVCTMALTQELASH-SVIVPRKAVLELSRLVSTSHDIVRLEIGSSNIRISMNGIVFT 234

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +LIDG FP+Y+ V+P + D+ L  +   L++A+ R +I+S+ + + V+LSLS + L +T
Sbjct: 235 SKLIDGRFPDYRRVLPRNADRILEADTETLKRALMRAAILSNEKFRGVRLSLSDNILKIT 294

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
            +NP+  +A E ++V Y    M++ FN  Y+L++++ +       + V F L  ++SS  
Sbjct: 295 ANNPEQEEAEEIIDVAYQSPAMEVGFNVSYVLDVLNTLKC-----ERVRFSLVDASSSCL 349

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           I    +D  NN      A YV+MPMR+
Sbjct: 350 I----EDCDNN-----TAEYVIMPMRL 367


>gi|268628311|gb|ACZ13554.1| DNA polymerase III beta chain [Xenorhabdus bovienii]
          Length = 276

 Score =  198 bits (504), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 104/269 (38%), Positives = 164/269 (60%), Gaps = 8/269 (2%)

Query: 65  GSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTKE 123
           G+ T+ A   +DI R L DGA+IS     EL G  + +  G S F L + P S+FP+  +
Sbjct: 15  GATTIPARKFFDIWRGLPDGAEISV----ELDGDRILVRSGRSRFSLSTLPASDFPNLDD 70

Query: 124 EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAV 183
            +    F L  + LK L+E T F+MA +++RYYLNG+ F   EE+L+   VATDGHRLAV
Sbjct: 71  WQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEEEELR--TVATDGHRLAV 128

Query: 184 AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID 243
             ++I  Q     S+IVPRK V E++R+L   DS +++ +  + I  ++     + +L+D
Sbjct: 129 CSMNI-GQNLPSHSVIVPRKGVIELMRLLDGGDSLLQLQIGSNNIRAHVGDFIFTSKLVD 187

Query: 244 GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPD 303
           G FP+Y+ V+P + DK L  NC  L+QA  R +I+S+ + + V++ LS ++L +T +NP+
Sbjct: 188 GRFPDYRRVLPKNPDKTLEANCDVLKQAFSRAAILSNEKFRGVRIYLSENQLRITANNPE 247

Query: 304 MGKAIESMNVYYNECPMDICFNYKYLLEI 332
             +A E ++V Y    M+I FN  Y+L++
Sbjct: 248 QEEAEEIVDVSYQGTEMEIGFNVSYVLDV 276


>gi|108761971|ref|YP_628517.1| DNA polymerase III subunit beta [Myxococcus xanthus DK 1622]
 gi|108465851|gb|ABF91036.1| DNA polymerase III, beta subunit [Myxococcus xanthus DK 1622]
          Length = 368

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 120/386 (31%), Positives = 209/386 (54%), Gaps = 19/386 (4%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+  +   ++ + L  A  I+ERK T+P+  +VL+ AN G + + A   +I +    PA 
Sbjct: 1   MEFRIAADELKKALYRAQGIVERKTTMPILANVLVTANKGGITVTAFDLDIGVVSEHPAE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V   G++T+SA  ++DIV+ L D AQ++  K       V+IS G ++F +      E+P 
Sbjct: 61  VIKTGAVTLSAKYVFDIVQNLPD-AQVTLKKLAN--NYVDISSGSAHFKIVGMAAEEYPK 117

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
             +EE     ++  + L  ++++T FA++++E RY LNG+FF       K+  VATDGHR
Sbjct: 118 LPKEENAPLVQVGGNTLLEMIKKTQFAISSDETRYILNGVFFEPQSTG-KVRMVATDGHR 176

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRIL-SSKDSSVKVSLSESRIHLNIESLSMSV 239
           LA+ E ++         +I+PRK + E+ R+L  + D+   +  +E+        L+M +
Sbjct: 177 LALVERELPGDFKLKSGVIIPRKGLMELKRLLDEAPDAECHLGFAENSALFKKPGLTMVM 236

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           RLIDG+FP YQ VIP   +K + V    L +++ R++++S+ +  AV++ L  ++L +T 
Sbjct: 237 RLIDGQFPEYQRVIPKEGEKIVLVPKVRLLESLKRIALLSADKSNAVRIGLEENQLIITA 296

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
            NPD+G+A + + + Y    + I FN +YL++++    +     DEV F L   +S   +
Sbjct: 297 SNPDLGEAKDVLELAYRGNGITIGFNARYLMDVLAVTET-----DEVSFELGDEHSPGVL 351

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
                      D    A  V+MPMR+
Sbjct: 352 HAPG-------DRSFTA--VVMPMRV 368


>gi|170724372|ref|YP_001758398.1| DNA polymerase III subunit beta [Shewanella woodyi ATCC 51908]
 gi|169809719|gb|ACA84303.1| DNA polymerase III, beta subunit [Shewanella woodyi ATCC 51908]
          Length = 366

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 116/387 (29%), Positives = 213/387 (55%), Gaps = 23/387 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK +++R  +L+ L      +ER++ +P+  ++L++ +   L++  +  E+E+ G +   
Sbjct: 1   MKFSIDRDALLKPLQLVTGAVERRHNLPILANLLVEVSGHSLKMTGTDLEVELVGQVQLE 60

Query: 61  VDVC-GSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESEF 118
            +V  G  T+ A    DIV+ L D  ++    +EN L     +  G S F L + P  E+
Sbjct: 61  GEVQEGRTTIPAKKFLDIVKSLPDQVELKIEQQENRL----LLRSGRSRFTLATLPAEEY 116

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P+ +  +    F +    LK+L++ T F+MA +++RYYLNG+      E   L A+ATDG
Sbjct: 117 PNVEAFQAEIEFTINQGTLKSLIDATQFSMANQDVRYYLNGLLLET--EGNVLRAIATDG 174

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMS 238
           HRLA++   I   + +   +IVPRK V E+ R+   ++  + +++ ++ I     S   +
Sbjct: 175 HRLALSHRQIQDTLPE-KQVIVPRKGVVELQRLFEGEELDITIAIGDNAIRATTASAVFT 233

Query: 239 VRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMT 298
            +L+DG FP+Y+ V+P   DK +  +  +L+QA+ R SI+S+ + + V++ L  + + +T
Sbjct: 234 SKLVDGRFPDYRRVLPKGGDKVVIASRNHLKQALLRASILSNEKFRGVRVQLEENLIKIT 293

Query: 299 VDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVF 358
            +NP+  +A E ++V Y   P++I FN  YLL++++N+ S     D+V   L   NSS  
Sbjct: 294 ANNPEQEEAEEILDVEYENTPLEIGFNVSYLLDVLNNLPS-----DDVRITLIDGNSSAL 348

Query: 359 IRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           I    ++         ++ YV+MPMR+
Sbjct: 349 IENHIEE---------DSMYVVMPMRL 366


>gi|71279230|ref|YP_266784.1| DNA polymerase III subunit beta [Colwellia psychrerythraea 34H]
 gi|71144970|gb|AAZ25443.1| DNA polymerase III, beta subunit [Colwellia psychrerythraea 34H]
          Length = 367

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 130/386 (33%), Positives = 214/386 (55%), Gaps = 20/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITG-AIPA 59
           MK ++ R  +L+ L      +ERK+T+P+  ++L + +   L + A+  E+E+   A   
Sbjct: 1   MKFSLNRELLLKPLLLVSGAVERKSTLPILSNILFEVSGQSLTLTATDLELEMVAYAEIQ 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
           +    G IT+ A  L DI + L + + ISF   +E    + +S G S + L + P  +FP
Sbjct: 61  NQGDDGKITIPARKLLDICKSLPESSLISFEVIDE---TIKLSSGRSKYSLSTLPAVDFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + +E +    F+L  S    L+E THF+MA +++RYYLNG+   I  E  ++ +VATDGH
Sbjct: 118 NIEEWKGDVEFQLLKSEFLRLIESTHFSMANQDVRYYLNGM--SIESEGNEIRSVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA+ ++           +IVPRK + EI+R+L+  D +V+V L  + I +     S + 
Sbjct: 176 RLAICKISNETLALPARQVIVPRKGILEIIRLLAPVDEAVQVFLGSNHIRIIDSEFSFTS 235

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG FP+Y+ V+P + DK    N   LRQ + R SI+S+ + + V+L+ S   L +T 
Sbjct: 236 KLVDGRFPDYRRVLPRNGDKVFETNKDALRQVLSRASILSNEKFKGVRLNFSDTNLKITA 295

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A E + + +    ++I FN  Y+L+++  I      D+ V F L  +NSSV I
Sbjct: 296 NNPEQEQAEEEIEINFPYGELEIGFNVSYVLDVLSAIK-----DENVKFTLADANSSVVI 350

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
            G    S N +     A YV+MPMR+
Sbjct: 351 EG----SSNGE-----ALYVVMPMRL 367


>gi|90019651|ref|YP_525478.1| DNA polymerase III subunit beta [Saccharophagus degradans 2-40]
 gi|89949251|gb|ABD79266.1| DNA polymerase III, beta subunit [Saccharophagus degradans 2-40]
          Length = 367

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 120/386 (31%), Positives = 208/386 (53%), Gaps = 20/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  V R  IL+ L     ++ER+ T+PV  +VL+      L +  +  E+EI G +   
Sbjct: 1   MKFIVSRETILKPLQLVAGVVERRQTLPVLANVLIVLEGEQLSLTGTDLEVEIVGRVTVD 60

Query: 61  VDVC-GSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
             +  G ITV A    DI R L DG+ I F  +++   +V +  G S F L S   +EFP
Sbjct: 61  QAISEGEITVPAKKFLDICRALPDGSVIEFTLDDQ---KVTVKSGRSRFTLSSLSANEFP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           + ++     +F      +K L++RT FAMA +++RYYLNG+ + +    L++  V+TDGH
Sbjct: 118 AVEQGSNDINFSCEQKEVKRLIDRTAFAMAQQDVRYYLNGMLWEVRAGALRV--VSTDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA+    I   +A+    I+PRK V E+ R+L+  + +V++++  + I       + + 
Sbjct: 176 RLAMCTRPINIDVAEPVQAILPRKGVIELSRLLNDSEENVELTMGPNHIRATTTEYTFTS 235

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +L+DG+FP+Y+ V+P   DK +      L+QA  R +I+S+ + + V+L L + +L +  
Sbjct: 236 KLVDGKFPDYERVLPKGGDKIVLGERAVLKQAFARTAILSNEKYRGVRLLLETGQLTIIA 295

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP+  +A + + V Y    +++ FN  YL ++ + + +     D++   L  SNSS  +
Sbjct: 296 NNPEQEEAEDQVAVEYEGDSIEVGFNVSYLQDVTNVLDT-----DKIKMTLSDSNSSALL 350

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
                +   N D    + YV+MPMR+
Sbjct: 351 -----EEPENAD----SVYVVMPMRL 367


>gi|53729133|ref|ZP_00134099.2| COG0592: DNA polymerase sliding clamp subunit (PCNA homolog)
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126207490|ref|YP_001052715.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae
           L20]
 gi|165975459|ref|YP_001651052.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|190149271|ref|YP_001967796.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|307244803|ref|ZP_07526902.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307249201|ref|ZP_07531198.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307262582|ref|ZP_07544213.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|126096282|gb|ABN73110.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|165875560|gb|ABY68608.1| DNA polymerase III beta chain [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|189914402|gb|ACE60654.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|306854248|gb|EFM86454.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306858725|gb|EFM90784.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306872080|gb|EFN03793.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 367

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 120/388 (30%), Positives = 213/388 (54%), Gaps = 24/388 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEIT--GAIP 58
           M+ T+ R  +L+ L   C ++  + T+PV  ++LL+     L +  +  E+E+T    + 
Sbjct: 1   MQFTITREQLLKPLQQVCGVLSSRPTLPVINNILLEIEGDRLSLTGTDLEVELTTVATLE 60

Query: 59  ASVDVCGSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESE 117
            +VD  G  T+ A    DI R L + + IS  F+E+       +    S F L + P S+
Sbjct: 61  QAVDFAGKFTIPAKKFLDICRSLPEDSSISVQFEEDR----ALVRAARSKFNLATLPASD 116

Query: 118 FPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATD 177
           +P+  + +    F +  S L  L++ T F+MA ++ RY+LNG+ F      L+   VATD
Sbjct: 117 YPNLMDWKPEVDFSIEQSTLARLIDATQFSMANQDARYFLNGMKFETEGNLLR--TVATD 174

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLAV  + +  ++    S+IVPRKAV E+ R+++  D +V++ +  S + +++  +  
Sbjct: 175 GHRLAVCTMALNQELLTH-SVIVPRKAVLELSRLVAVSDETVRLEIGTSNLRVSMNGVVF 233

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +LIDG FP+Y+ V+P + D+ L      L++A+ R +I+S+ + + V+L+LS + L +
Sbjct: 234 TSKLIDGRFPDYRRVLPRNADRILEAETEVLKRALMRAAILSNEKFRGVRLALSENLLKI 293

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           T +NP+  +A E ++V Y    M++ FN  YLL++++ +       + V F L  ++SS 
Sbjct: 294 TANNPEQEEAEEIIDVAYQSPEMEVGFNVSYLLDVLNTLKC-----ERVRFNLVDASSSC 348

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            I   D  +         A YV+MPMR+
Sbjct: 349 LIEDCDNST---------AEYVIMPMRL 367


>gi|256821230|ref|YP_003145193.1| DNA polymerase III subunit beta [Kangiella koreensis DSM 16069]
 gi|256794769|gb|ACV25425.1| DNA polymerase III, beta subunit [Kangiella koreensis DSM 16069]
          Length = 367

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 124/390 (31%), Positives = 210/390 (53%), Gaps = 28/390 (7%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ T+ R  +L  L      +E++ T+PV  +VL+  +D  L + A+  E+E+     A 
Sbjct: 1   MRFTISRDQLLAPLQLVSGAVEKRQTLPVLSNVLMVVDDSKLSLTATDLEVELK----AQ 56

Query: 61  VDV-----CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPE 115
           VD+      G ITV A  L DIVR L DG  +   K  +  T + +    S F L +   
Sbjct: 57  VDLEGEFEPGEITVPARKLLDIVRSLGDGENV---KIEQSETRLKVITPSSRFSLSTMSA 113

Query: 116 SEFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVA 175
           +EFP+  E   + S EL   VLK+L+E+T FAMA +++RYYLNG+ F  + +  KL  VA
Sbjct: 114 NEFPNLDETVSLASLELTQDVLKSLIEKTQFAMAQQDVRYYLNGMLFEFDND--KLTTVA 171

Query: 176 TDGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESL 235
           TDGHRLA++            S I+PRK V E+ R+L   D ++ ++L  + I +     
Sbjct: 172 TDGHRLALSRAKASIDADDKISAIIPRKGVTELARLLEHSDDNITLNLGSNHIKVIGPDY 231

Query: 236 SMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKL 295
           S + +L+DG FP Y+ V+P + DK +  +    ++++ R SI+ + + + V+  L+++++
Sbjct: 232 SFTSKLVDGRFPEYEKVLPRNGDKIVIADRELFKESLSRASILCNEKFRGVRFMLTNEQV 291

Query: 296 CMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNS 355
            +  +NP+  +A     V Y    ++I FN  Y++++++ I + +V   ++ F +D +NS
Sbjct: 292 RLHANNPEQEEAEVEFGVDYQGSDLEIGFNVSYMIDVMNTIKTPQV---KLTF-ID-ANS 346

Query: 356 SVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           S  I   D            + YV+MPMR+
Sbjct: 347 STLIEEVDGGE---------SVYVVMPMRL 367


>gi|88798538|ref|ZP_01114122.1| DNA polymerase III subunit beta [Reinekea sp. MED297]
 gi|88778638|gb|EAR09829.1| DNA polymerase III subunit beta [Reinekea sp. MED297]
          Length = 369

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 120/390 (30%), Positives = 218/390 (55%), Gaps = 27/390 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAI--- 57
           ++ ++ R  +L+ L     ++E++ T+PV  +VLL+     L +  +  E+E+ G +   
Sbjct: 2   IQFSLAREQLLKPLQLVSGVVEKRQTLPVLSNVLLEVEGNQLALTGTDLEVELIGRVELS 61

Query: 58  -PASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPES 116
            PAS    G+ITV A    DIVR L + A IS  +  +    V ++ G S F L S P +
Sbjct: 62  EPAS---DGAITVPAKKFLDIVRSLPEDAIISLQQTED---RVQVASGRSKFTLSSLPAT 115

Query: 117 EFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVAT 176
           EFP+ +++E    + L  ++L  L++ T FAMA +++RYYLNG+   +N+  ++   V+T
Sbjct: 116 EFPNIEQDENAQEYRLPQNLLSQLIDATAFAMAQQDVRYYLNGMSVELNQSLVR--TVST 173

Query: 177 DGHRLAVAEVDIVA-QIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESL 235
           DGHRLA++   +    + +   +IVPRK + E+ R+LS  D  V++ +  + +    +  
Sbjct: 174 DGHRLAMSSRHVDGLNVPERKQVIVPRKGILELNRLLSDDDQPVQLYIGSTHLRTTTDEF 233

Query: 236 SMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKL 295
           + + +L+DG+FP+Y+ VIP   DKE+  +   ++    R +I+++ + + V++SLS   L
Sbjct: 234 TFTTKLVDGKFPDYERVIPRGGDKEVVGDRQVMKAIFSRAAILANEKYRGVRMSLSEGSL 293

Query: 296 CMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNS 355
            +  +NP+  +A  ++ V Y+   +++ FN  YLL++++ I       ++V F L  +NS
Sbjct: 294 VVKANNPEQEEAEVAVEVDYSGPELEVGFNVSYLLDVMNVIRG-----EQVRFVLADANS 348

Query: 356 SVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
           S  +   D DS         + YV+MPMR+
Sbjct: 349 SALLTDFDDDS---------SMYVVMPMRL 369


>gi|15603025|ref|NP_246097.1| DNA polymerase III subunit beta [Pasteurella multocida subsp.
           multocida str. Pm70]
 gi|12721508|gb|AAK03244.1| DnaN [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 366

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 126/386 (32%), Positives = 206/386 (53%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEI-TGAIPA 59
           M+  V R ++L+ L   C ++  +  IPV  +VLLQ     L I  +  E+E+ T     
Sbjct: 1   MQFIVSRENLLKPLQQVCGVLSSRPNIPVLNNVLLQIRGERLVITGTDLEVELSTETALL 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
             DV GS T+ A    DI R L + A+IS   E +      +  G S F L + P  E+P
Sbjct: 61  RTDVQGSFTIPAKKFLDICRSLPEEAEISVSFEEDRAI---VKSGRSKFNLSTLPAEEYP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  S L+ L+E T F+MA ++ RY+LNG+ F      L+   VATDGH
Sbjct: 118 NLTDWQSEVDFTLEQSTLRRLIEATQFSMANQDARYFLNGMKFETEGNLLR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + +  Q  +  S+I+PRK V E++R+L + D   ++ +  + + +++ ++  + 
Sbjct: 176 RLAVCTIAL-EQDLQTHSVILPRKGVLELVRLLENTDLPARLQIGTNNLRIDLGNIIFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +LIDG FP+Y+ V+P +  + L      L+QA  R +I+S+ R ++V+L LS ++L +T 
Sbjct: 235 KLIDGRFPDYRRVLPRNATRILEAEWDVLKQAFVRAAILSNERFRSVRLQLSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
            NP+   A E ++V Y    M++ FN  Y+L++++ +         V  RL  ++SS  I
Sbjct: 295 TNPEQEVAEEIIDVSYVGEEMEVGFNVSYILDVLNALKC-----QRVRMRLTDASSSCLI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              D  S         A YV+MPMR+
Sbjct: 350 EDCDDAS---------AEYVIMPMRL 366


>gi|268628295|gb|ACZ13546.1| DNA polymerase III beta chain [Xenorhabdus hominickii]
 gi|268628297|gb|ACZ13547.1| DNA polymerase III beta chain [Xenorhabdus hominickii]
 gi|268628299|gb|ACZ13548.1| DNA polymerase III beta chain [Xenorhabdus hominickii]
          Length = 276

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 103/269 (38%), Positives = 163/269 (60%), Gaps = 8/269 (2%)

Query: 65  GSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTKE 123
           G+ TV A   +DI R L DGA+IS     EL G  + +  G S F L + P S+FP+  +
Sbjct: 15  GATTVPARKFFDIWRGLPDGAEISV----ELDGDRILVRSGRSRFSLSTLPASDFPNLDD 70

Query: 124 EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAV 183
            +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGHRLAV
Sbjct: 71  WQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGHRLAV 128

Query: 184 AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID 243
             ++I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + +L+D
Sbjct: 129 CSMNI-GQNLPSHSVIVPRKGVIELMRLLDGGDNPLQLQIGSNNIRAHVGDFIFTSKLVD 187

Query: 244 GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPD 303
           G FP+Y+ V+P + DK L  NC  L+QA  R +I+S+ + + V++ LS ++L +T +NP+
Sbjct: 188 GRFPDYRRVLPKNPDKTLEANCDTLKQAFSRAAILSNEKFRGVRIYLSENQLRITANNPE 247

Query: 304 MGKAIESMNVYYNECPMDICFNYKYLLEI 332
             +A E ++V Y    M+I FN  Y+L++
Sbjct: 248 QEEAEEIVDVSYQGTEMEIGFNVSYVLDV 276


>gi|58697440|ref|ZP_00372737.1| DNA polymerase III, beta subunit [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|58536133|gb|EAL59745.1| DNA polymerase III, beta subunit [Wolbachia endosymbiont of
           Drosophila simulans]
          Length = 353

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 125/371 (33%), Positives = 210/371 (56%), Gaps = 20/371 (5%)

Query: 14  LGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPASVDVCGSITVSAHL 73
           L     ++ER+N+I V   + ++A  G +++ A+  +I +  ++ A+V   G + +SAH 
Sbjct: 2   LSRVSGVVERRNSIDVLACINIKAQHGSIKLMATDLDISMFASLAATVLTEGEVKISAHT 61

Query: 74  LYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPSTKEEEYVYSFELA 133
           L+DIV+KL     ++F   N+   ++ +S G++NF L +   S FP+ +E+ Y + F L 
Sbjct: 62  LHDIVKKLPADLDVNFEVNNQ--GKLLMSCGNANFSLPNVVSSSFPALEEDNYKHDFILL 119

Query: 134 SSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAVAEVDIVAQIA 193
           ++ L +L+ +T FA++ ++ RY LNGI+ H +E+   L  VATDGHRL+  +      I 
Sbjct: 120 NTDLIDLLTKTKFAVSLDDTRYNLNGIYLHTDEQ--FLYCVATDGHRLSCIKRPKPGNIN 177

Query: 194 KMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLIDGEFPNYQNVI 253
               +I+PRK V E+L+IL   +  +KV LS+ +I L      +  +LIDG FPNY+ VI
Sbjct: 178 GEFGVIIPRKTVMELLKILDDCNE-IKVKLSDRKIKLTCGEYILISKLIDGTFPNYKAVI 236

Query: 254 PCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPDMGKAIESMNV 313
           P S DK + +    L   +DRVS++ S +++++K SL    L +  ++ +   A ES+ V
Sbjct: 237 PASQDKHMIIESKKLSDVIDRVSVVVSDKVKSIKFSLQEKLLTLHSNSQECSDATESIEV 296

Query: 314 YYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIRGKDKDSKNNKDNK 373
            YNE P++I FN +YLL+++        + ++  F L   NS+  I  +D  S       
Sbjct: 297 DYNEAPIEIGFNSRYLLDVL------SCIKNKCKFSLADGNSATIITDEDDSS------- 343

Query: 374 VNAFYVLMPMR 384
               YV+MPMR
Sbjct: 344 --VLYVVMPMR 352


>gi|71905644|ref|YP_283231.1| DNA polymerase III, beta subunit [Dechloromonas aromatica RCB]
 gi|71845265|gb|AAZ44761.1| DNA polymerase III, beta subunit [Dechloromonas aromatica RCB]
          Length = 368

 Score =  197 bits (500), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 121/387 (31%), Positives = 217/387 (56%), Gaps = 26/387 (6%)

Query: 3   ITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIP-ASV 61
           I  +R  +L  L     I+ER++T+P+  +VLL+     L + A+  EI+IT +   A  
Sbjct: 4   IKTQRDTLLAPLQSVSGIVERRHTLPILSNVLLEKKGDRLTLLATDIEIQITTSTECAGG 63

Query: 62  DVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS- 120
           +  G++TV A  + +I+R L D +++S   E++    + +  G S F LQ+ P  +FP  
Sbjct: 64  EGDGAVTVGARKMQEILRSLPDTSEVSLVLEDK---RLQVRAGKSRFSLQTLPADDFPRM 120

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
           T  E     F ++    + L+ +T ++MA +++RYYLNG+   +  ++L+  AVATDGHR
Sbjct: 121 TMSEGETKQFSISQKAFRQLISKTQYSMAAQDVRYYLNGLLLLVEGKELR--AVATDGHR 178

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LA A V+I   + +   +I+PRK V E+ R+L   D  + ++L+ +++  +  S+ +  +
Sbjct: 179 LAYASVEIDTDLPRQ-EMILPRKTVLELNRLLVDTDDLLNITLTPNQVRFSFGSVVLVSK 237

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDG+FP+Y+ V+P +    ++V    L QA+ R +I+++ + + V++ L  + L +   
Sbjct: 238 LIDGKFPDYERVVPATLKNHMKVGRQTLMQAMQRAAILTNEKFRGVRVVLGDNSLKLIAA 297

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           N +  +A+E + V Y    +D+ FN  YLL++++NI +     DE+ +  + +NSS  I 
Sbjct: 298 NAEQEEAVEEIEVDYTGDVIDVGFNVGYLLDVLNNIHA-----DEIQWSFNDANSSALIT 352

Query: 361 --GKDKDSKNNKDNKVNAFYVLMPMRI 385
             G D+             YV+MPMRI
Sbjct: 353 LPGNDRFK-----------YVVMPMRI 368


>gi|307253757|ref|ZP_07535611.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307258214|ref|ZP_07539957.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306863241|gb|EFM95181.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306867674|gb|EFM99519.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
          Length = 367

 Score =  197 bits (500), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 120/388 (30%), Positives = 212/388 (54%), Gaps = 24/388 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEIT--GAIP 58
           M+ T+ R  +L+ L   C ++  + T+PV  ++LL+     L +  +  E+E+T    + 
Sbjct: 1   MQFTITREQLLKPLQQVCGVLSSRPTLPVINNILLEIEGDRLSLTGTDLEVELTTVATLE 60

Query: 59  ASVDVCGSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESE 117
            +VD  G  T+ A    DI R L + + IS  F+E+       +    S F L + P S+
Sbjct: 61  QAVDFAGKFTIPAKKFLDICRSLPEDSSISVQFEEDR----ALVRAARSKFNLATLPASD 116

Query: 118 FPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATD 177
           +P+  + +    F +  S L  L++ T F+MA ++ RY+LNG+ F      L+   VATD
Sbjct: 117 YPNLMDWKPEVDFSIEQSTLARLIDATQFSMANQDARYFLNGMKFETEGNLLR--TVATD 174

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLAV  + +  ++    S+IVPRKAV E+ R+++  D +V++ +  S +  ++  +  
Sbjct: 175 GHRLAVCTMALNQELLTH-SVIVPRKAVLELSRLVAVSDETVRLEIGTSNLRASMNGVVF 233

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +LIDG FP+Y+ V+P + D+ L      L++A+ R +I+S+ + + V+L+LS + L +
Sbjct: 234 TSKLIDGRFPDYRRVLPRNADRILEAETEVLKRALMRAAILSNEKFRGVRLALSENLLKI 293

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           T +NP+  +A E ++V Y    M++ FN  YLL++++ +       + V F L  ++SS 
Sbjct: 294 TANNPEQEEAEEIIDVAYQSPEMEVGFNVSYLLDVLNTLKC-----ERVRFNLVDASSSC 348

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            I   D  +         A YV+MPMR+
Sbjct: 349 LIEDCDNST---------AEYVIMPMRL 367


>gi|322513484|ref|ZP_08066594.1| DNA-directed DNA polymerase III beta subunit [Actinobacillus ureae
           ATCC 25976]
 gi|322120703|gb|EFX92587.1| DNA-directed DNA polymerase III beta subunit [Actinobacillus ureae
           ATCC 25976]
          Length = 367

 Score =  197 bits (500), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 120/388 (30%), Positives = 212/388 (54%), Gaps = 24/388 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEIT--GAIP 58
           M+ T+ R  +L+ L   C ++  + T+PV  ++LL+     L +  +  E+E+T    + 
Sbjct: 1   MQFTITREQLLKPLQQVCGVLSSRPTLPVINNILLEIEGDRLSLTGTDLEVELTTVATLE 60

Query: 59  ASVDVCGSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESE 117
            +VD  G  T+ A    DI R L + + IS  F+E        +    S F L + P S+
Sbjct: 61  QAVDFAGKFTIPAKKFLDICRSLPEDSSISVQFEE----YRALVRAARSKFNLATLPASD 116

Query: 118 FPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATD 177
           +P+  + +    F +  S L  L++ T F+MA ++ RY+LNG+ F      L+   VATD
Sbjct: 117 YPNLMDWKPEVDFSIEQSTLARLIDATQFSMANQDARYFLNGMKFETEGNLLR--TVATD 174

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLAV  + +  ++    S+IVPRKAV E+ R+++  D +V++ +  S + +++  +  
Sbjct: 175 GHRLAVCTMALNQELLTH-SVIVPRKAVLELSRLVAVSDETVRLEIGTSNLRVSMNGVVF 233

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +LIDG FP+Y+ V+P + D+ L      L++A+ R +I+S+ + + V+L+LS + L +
Sbjct: 234 TSKLIDGRFPDYRRVLPRNADRILEAETEVLKRALMRAAILSNEKFRGVRLALSENLLKI 293

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           T +NP+  +A E ++V Y    M++ FN  YLL++++ +       + V F L  ++SS 
Sbjct: 294 TANNPEQEEAEEIIDVAYQSLEMEVGFNVSYLLDVLNTLKC-----ERVRFNLVDASSSC 348

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            I   D  +         A YV+MPMR+
Sbjct: 349 LIEDCDNST---------AEYVIMPMRL 367


>gi|307260452|ref|ZP_07542147.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|306869855|gb|EFN01637.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
          Length = 367

 Score =  197 bits (500), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 120/388 (30%), Positives = 213/388 (54%), Gaps = 24/388 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEIT--GAIP 58
           M+ T+ R  +L+ L   C ++  + T+PV  ++LL+     L +  +  E+E+T    + 
Sbjct: 1   MQFTITREQLLKPLQQVCGVLSSRPTLPVINNILLEIEGDRLSLTGTDLEVELTTVAILE 60

Query: 59  ASVDVCGSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESE 117
            +VD  G  T+ A    DI R L + + IS  F+E+       +    S F L + P S+
Sbjct: 61  QAVDFAGKFTIPAKKFLDICRSLPEDSSISVQFEEDR----ALVRAARSKFNLATLPASD 116

Query: 118 FPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATD 177
           +P+  + +    F +  S L  L++ T F+MA ++ RY+LNG+ F      L+   VATD
Sbjct: 117 YPNLMDWKPEVDFSIEQSTLARLIDATQFSMANQDARYFLNGMKFETEGNLLR--TVATD 174

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLAV  + +  ++    S+IVPRKAV E+ R+++  D +V++ +  S + +++  +  
Sbjct: 175 GHRLAVCTMALNQELLTH-SVIVPRKAVLELSRLVAVSDETVRLEIGTSNLRVSMNGVVF 233

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +LIDG FP+Y+ V+P + D+ L      L++A+ R +I+S+ + + V+L+LS + L +
Sbjct: 234 TSKLIDGRFPDYRRVLPRNADRILEAETEVLKRALMRAAILSNEKFRGVRLALSENLLKI 293

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           T +NP+  +A E ++V Y    M++ FN  YLL++++ +       + V F L  ++SS 
Sbjct: 294 TANNPEQEEAEEIIDVAYQSPEMEVGFNVSYLLDVLNTLKC-----ERVRFNLVDASSSC 348

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            I   D  +         A YV+MPMR+
Sbjct: 349 LIEDCDNST---------AEYVIMPMRL 367


>gi|268628287|gb|ACZ13542.1| DNA polymerase III beta chain [Xenorhabdus koppenhoeferi]
          Length = 276

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 103/269 (38%), Positives = 162/269 (60%), Gaps = 8/269 (2%)

Query: 65  GSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTKE 123
           G+ TV A   +DI R L DGA+IS     EL G  + +  G S F L + P S+FP+   
Sbjct: 15  GATTVPARKFFDIWRGLPDGAEISV----ELDGDRILVRSGRSRFSLSTLPASDFPNLDH 70

Query: 124 EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAV 183
            +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGHRLAV
Sbjct: 71  WQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGHRLAV 128

Query: 184 AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID 243
             ++I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + +L+D
Sbjct: 129 CSMNI-GQNLPSHSVIVPRKGVIELMRLLDGGDNPLQLQIGSNNIRAHVGDFIFTSKLVD 187

Query: 244 GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPD 303
           G FP+Y+ V+P + DK L  NC  L+QA  R +I+S+ + + V++ LS ++L +T +NP+
Sbjct: 188 GRFPDYRRVLPKNPDKTLEANCDTLKQAFSRAAILSNEKFRGVRIYLSENQLKITANNPE 247

Query: 304 MGKAIESMNVYYNECPMDICFNYKYLLEI 332
             +A E ++V Y    M+I FN  Y+L++
Sbjct: 248 QEEAEEIVDVSYQGTEMEIGFNVSYVLDV 276


>gi|268628317|gb|ACZ13557.1| DNA polymerase III beta chain [Xenorhabdus cabanillasii]
          Length = 276

 Score =  196 bits (499), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 164/269 (60%), Gaps = 8/269 (2%)

Query: 65  GSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTKE 123
           G+ T+ A   +DI R L DGA+IS     EL G  + +  G S F L + P S+FP+  +
Sbjct: 15  GATTIPARKFFDIWRGLPDGAEISV----ELDGDRILVRSGRSRFSLSTLPASDFPNLDD 70

Query: 124 EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAV 183
            +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGHRLAV
Sbjct: 71  WQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGHRLAV 128

Query: 184 AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID 243
             ++I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + +L+D
Sbjct: 129 CSMNI-GQSLPSHSVIVPRKGVIELMRLLDGGDTPLQLXIGSNNIRAHVGDFIFTSKLVD 187

Query: 244 GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPD 303
           G FP+Y+ V+P + DK L  NC  L+QA  R +I+S+ + + V++ LS ++L +T +NP+
Sbjct: 188 GRFPDYRRVLPKNPDKTLEANCDMLKQAFSRAAILSNEKFRGVRIYLSENQLRITANNPE 247

Query: 304 MGKAIESMNVYYNECPMDICFNYKYLLEI 332
             +A E ++V Y+   M+I FN  Y+L++
Sbjct: 248 QEEAEEIVDVNYHGAEMEIGFNVSYVLDV 276


>gi|268628367|gb|ACZ13582.1| DNA polymerase III beta chain [Photorhabdus luminescens subsp.
           laumondii]
          Length = 276

 Score =  196 bits (499), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 102/270 (37%), Positives = 162/270 (60%), Gaps = 8/270 (2%)

Query: 64  CGSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTK 122
            G+ TV A   +DI R L DGA+IS     EL G  + +  G S F L + P S+FP+  
Sbjct: 14  AGATTVPARKFFDIWRGLPDGAEISV----ELDGDRLLVRSGRSRFSLSTLPASDFPNLD 69

Query: 123 EEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLA 182
           + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGHRLA
Sbjct: 70  DWQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGHRLA 127

Query: 183 VAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLI 242
           V  + I  ++    S+IVPRK V E++R+L   D+ +++ +  + I  ++     + +L+
Sbjct: 128 VCSMGIGQKLPSH-SVIVPRKGVIELMRLLDGGDTPLQLQIGSNNIRAHVGDFIFTSKLV 186

Query: 243 DGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNP 302
           DG FP+Y+ V+P + DK L  NC  L+QA  R +I+S+ + + V+L  S ++L +T +NP
Sbjct: 187 DGRFPDYRRVLPKNPDKTLEANCDMLKQAFSRAAILSNEKFRGVRLYFSENQLRITANNP 246

Query: 303 DMGKAIESMNVYYNECPMDICFNYKYLLEI 332
           +  +A E ++V Y    M+I FN  Y+L++
Sbjct: 247 EQEEAEEIVDVSYQGAEMEIGFNVSYVLDV 276


>gi|268628377|gb|ACZ13587.1| DNA polymerase III beta chain [Photorhabdus luminescens subsp.
           hainanensis]
          Length = 276

 Score =  196 bits (498), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 162/269 (60%), Gaps = 8/269 (2%)

Query: 65  GSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTKE 123
           G+ TV A   +DI R L DGA+IS     EL G  + +  G S F L + P S+FP+  +
Sbjct: 15  GATTVPARKFFDIWRGLPDGAEISV----ELDGDRLLVRSGRSRFSLSTLPASDFPNLDD 70

Query: 124 EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAV 183
            +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGHRLAV
Sbjct: 71  WQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGHRLAV 128

Query: 184 AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID 243
             + I  ++    S+IVPRK V E++R+L   D+ +++ +  + I  ++     + +L+D
Sbjct: 129 CSMGIGQKLPSH-SVIVPRKGVIELMRLLDGGDTPLQLQIGSNNIRAHVGDFIFTSKLVD 187

Query: 244 GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPD 303
           G FP+Y+ V+P + DK L  NC  L+QA  R +I+S+ + + V+L  S ++L +T +NP+
Sbjct: 188 GRFPDYRRVLPKNPDKTLEANCDMLKQAFSRAAILSNEKFRGVRLYFSENQLKITANNPE 247

Query: 304 MGKAIESMNVYYNECPMDICFNYKYLLEI 332
             +A E ++V Y    M+I FN  Y+L++
Sbjct: 248 QEEAEEIVDVSYQGAEMEIGFNVSYVLDV 276


>gi|268628291|gb|ACZ13544.1| DNA polymerase III beta chain [Xenorhabdus miraniensis]
          Length = 276

 Score =  196 bits (498), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 103/269 (38%), Positives = 163/269 (60%), Gaps = 8/269 (2%)

Query: 65  GSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTKE 123
           G+ TV A   +DI R L DGA+IS     EL G  + +  G S F L + P S+FP+  +
Sbjct: 15  GATTVPARKFFDIWRGLPDGAEISV----ELDGDRILVRSGRSRFSLSTLPASDFPNLDD 70

Query: 124 EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAV 183
            +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGHRLAV
Sbjct: 71  WQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGHRLAV 128

Query: 184 AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID 243
             ++I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + +L+D
Sbjct: 129 CSMNI-GQNLPSHSVIVPRKGVIELMRLLDGGDNPLQLQIGSNNIRAHVGDFIFTSKLVD 187

Query: 244 GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPD 303
           G FP+Y+ V+P + DK L  NC  L+QA  R +I+S+ + + V++ LS ++L +T +NP+
Sbjct: 188 GRFPDYRRVLPKNPDKTLEANCDMLKQAFSRAAILSNEKFRGVRIYLSENQLRITANNPE 247

Query: 304 MGKAIESMNVYYNECPMDICFNYKYLLEI 332
             +A E ++V Y    M+I FN  Y+L++
Sbjct: 248 QEEAEEIVDVSYRGTEMEIGFNVSYVLDV 276


>gi|268628313|gb|ACZ13555.1| DNA polymerase III beta chain [Xenorhabdus indica]
 gi|268628315|gb|ACZ13556.1| DNA polymerase III beta chain [Xenorhabdus indica]
          Length = 276

 Score =  196 bits (498), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 164/269 (60%), Gaps = 8/269 (2%)

Query: 65  GSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTKE 123
           G+ T+ A   +DI R L DGA+IS     EL G  + +  G S F L + P S+FP+  +
Sbjct: 15  GATTIPARKFFDIWRGLPDGAEISV----ELDGDRILVRSGRSRFSLSTLPASDFPNLDD 70

Query: 124 EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAV 183
            +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGHRLAV
Sbjct: 71  WQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGHRLAV 128

Query: 184 AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID 243
             ++I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + +L+D
Sbjct: 129 CSMNI-GQSLPSHSVIVPRKGVIELMRLLDGGDNPLQLQIGSNNIRAHVGDFIFTSKLVD 187

Query: 244 GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPD 303
           G FP+Y+ V+P + DK L  NC  L+QA  R +I+S+ + + V++ LS ++L +T +NP+
Sbjct: 188 GRFPDYRRVLPKNPDKTLEANCDMLKQAFSRAAILSNEKFRGVRIYLSENQLRITANNPE 247

Query: 304 MGKAIESMNVYYNECPMDICFNYKYLLEI 332
             +A E ++V Y+   M+I FN  Y+L++
Sbjct: 248 QEEAEEIVDVNYHGAEMEIGFNVSYVLDV 276


>gi|240950076|ref|ZP_04754378.1| DNA polymerase III subunit beta [Actinobacillus minor NM305]
 gi|240295451|gb|EER46206.1| DNA polymerase III subunit beta [Actinobacillus minor NM305]
          Length = 367

 Score =  196 bits (498), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 122/388 (31%), Positives = 214/388 (55%), Gaps = 24/388 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEIT--GAIP 58
           M  T+ R  +++ L   C ++  + T+PV  ++LL+     L +  +  E+E+T    + 
Sbjct: 1   MLFTITREQLIKPLQQVCGVLSSRPTLPVIANLLLEVEGDRLLMTGTDLEVELTTEARLA 60

Query: 59  ASVDVCGSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESE 117
             VD     T+ A    DI R L + + IS  F+E++      +  G S F L + P S+
Sbjct: 61  QEVDFSEKFTIPAKKFLDISRSLPEDSLISMSFEEDK----AILKAGRSKFSLATLPASD 116

Query: 118 FPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATD 177
           +P+  +      F +  S L  L++ T F+MA ++ RY+LNG+ F      L+   VATD
Sbjct: 117 YPNLMDWTPEVDFSIEQSTLARLIDATQFSMANQDARYFLNGMKFETEGNLLR--TVATD 174

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLAV  + +  ++A   S+IVPRKAV E+ R++S+    V++ +  S I +++  +  
Sbjct: 175 GHRLAVCTMALTQELASH-SVIVPRKAVLELSRLVSANHDIVRLEIGSSNIRISMNGIVF 233

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +LIDG FP+Y+ V+P + D+ L  +   L++A+ R +I+S+ + + V+LSL+ + L +
Sbjct: 234 TSKLIDGRFPDYRRVLPRNADRILEADTETLKRALMRAAILSNEKFRGVRLSLNDNVLKI 293

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           T +NP+  +A E ++V Y    M++ FN  Y+L++++ +       + V F L  ++SS 
Sbjct: 294 TANNPEQEEAEEIIDVAYQSPAMEVGFNVSYVLDVLNTLKC-----ERVRFSLVDASSSC 348

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
            I    +D  NN      A YV+MPMR+
Sbjct: 349 LI----EDCDNN-----TAEYVIMPMRL 367


>gi|268628357|gb|ACZ13577.1| DNA polymerase III beta chain [Photorhabdus luminescens subsp.
           kayaii]
 gi|268628359|gb|ACZ13578.1| DNA polymerase III beta chain [Photorhabdus luminescens subsp.
           kayaii]
 gi|268628361|gb|ACZ13579.1| DNA polymerase III beta chain [Photorhabdus luminescens subsp.
           kayaii]
 gi|268628363|gb|ACZ13580.1| DNA polymerase III beta chain [Photorhabdus luminescens subsp.
           kayaii]
 gi|268628365|gb|ACZ13581.1| DNA polymerase III beta chain [Photorhabdus luminescens subsp.
           kayaii]
          Length = 276

 Score =  196 bits (498), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 162/269 (60%), Gaps = 8/269 (2%)

Query: 65  GSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTKE 123
           G+ TV A   +DI R L DGA+IS     EL G  + +  G S F L + P S+FP+  +
Sbjct: 15  GATTVPARKFFDIWRGLPDGAEISV----ELDGDRLLVRSGRSRFSLSTLPASDFPNLDD 70

Query: 124 EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAV 183
            +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGHRLAV
Sbjct: 71  WQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGHRLAV 128

Query: 184 AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID 243
             + I  ++    S+IVPRK V E++R+L   D+ +++ +  + I  ++     + +L+D
Sbjct: 129 CSMGIGQKLPSH-SVIVPRKGVIELMRLLDGGDTPLQLQIGSNNIRAHVGDFIFTSKLVD 187

Query: 244 GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPD 303
           G FP+Y+ V+P + DK L  NC  L+QA  R +I+S+ + + V+L  S ++L +T +NP+
Sbjct: 188 GRFPDYRRVLPKNPDKTLEANCDMLKQAFSRAAILSNEKFRGVRLYFSENQLKITANNPE 247

Query: 304 MGKAIESMNVYYNECPMDICFNYKYLLEI 332
             +A E ++V Y    M+I FN  Y+L++
Sbjct: 248 QEEAEEIVDVSYQGAEMEIGFNVSYVLDV 276


>gi|268628327|gb|ACZ13562.1| DNA polymerase III beta chain [Xenorhabdus stockiae]
          Length = 276

 Score =  196 bits (497), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 163/269 (60%), Gaps = 8/269 (2%)

Query: 65  GSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTKE 123
           G+ T+ A   +DI R L DGA+IS     EL G  + +  G S F L + P S+FP+  +
Sbjct: 15  GATTIPARKFFDIWRGLPDGAEISV----ELDGDRILVRSGRSRFSLSTLPASDFPNLDD 70

Query: 124 EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAV 183
            +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGHRLAV
Sbjct: 71  WQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGHRLAV 128

Query: 184 AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID 243
             ++I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + +L+D
Sbjct: 129 CSMNI-GQSLPSHSVIVPRKGVIELMRLLDGGDNPLQLQIGSNNIRAHVGDFIFTSKLVD 187

Query: 244 GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPD 303
           G FP+Y+ V+P + DK L  NC  L+QA  R +I+S+ + + V++ LS ++L +T +NP+
Sbjct: 188 GRFPDYRRVLPKNPDKTLIANCDTLKQAFSRAAILSNEKFRGVRIYLSENQLRITANNPE 247

Query: 304 MGKAIESMNVYYNECPMDICFNYKYLLEI 332
             +A E ++V Y    M+I FN  Y+L++
Sbjct: 248 QEEAEEIVDVSYQGTEMEIGFNVSYVLDV 276


>gi|268628379|gb|ACZ13588.1| DNA polymerase III beta chain [Photorhabdus luminescens subsp.
           akhurstii]
          Length = 276

 Score =  196 bits (497), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 162/269 (60%), Gaps = 8/269 (2%)

Query: 65  GSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTKE 123
           G+ TV A   +DI R L DGA+IS     EL G  + +  G S F L + P S+FP+  +
Sbjct: 15  GATTVPARKFFDIWRGLPDGAEISV----ELDGDRLLVRSGRSRFSLSTLPASDFPNLDD 70

Query: 124 EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAV 183
            +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGHRLAV
Sbjct: 71  WQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGHRLAV 128

Query: 184 AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID 243
             + I  ++    S+IVPRK V E++R+L   D+ +++ +  + I  ++     + +L+D
Sbjct: 129 CSMGIGQKLPSH-SVIVPRKGVIELMRLLDGGDTPLQLQIGSNNIRAHVGDFIFTSKLVD 187

Query: 244 GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPD 303
           G FP+Y+ V+P + DK L  NC  L+QA  R +I+S+ + + V+L  S ++L +T +NP+
Sbjct: 188 GRFPDYRRVLPKNPDKTLEANCDMLKQAFSRAAILSNEKFRGVRLYFSENQLKITANNPE 247

Query: 304 MGKAIESMNVYYNECPMDICFNYKYLLEI 332
             +A E ++V Y    M+I FN  Y+L++
Sbjct: 248 QEEAEEIVDVSYQGTEMEIGFNVSYVLDV 276


>gi|268628279|gb|ACZ13538.1| DNA polymerase III beta chain [Xenorhabdus japonica]
          Length = 276

 Score =  196 bits (497), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 103/269 (38%), Positives = 163/269 (60%), Gaps = 8/269 (2%)

Query: 65  GSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTKE 123
           G+ TV A   +DI R L DGA+IS     EL G  + +  G S F L + P S+FP+  +
Sbjct: 15  GATTVPARKFFDIWRGLPDGAKISV----ELDGDRILVRSGRSRFSLSTLPASDFPNLDD 70

Query: 124 EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAV 183
            +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGHRLAV
Sbjct: 71  WQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGHRLAV 128

Query: 184 AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID 243
             + I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + +L+D
Sbjct: 129 CSMSI-GQNLPSHSVIVPRKGVIELMRLLDGGDNPLQLQIGSNNIRAHVGDFIFTSKLVD 187

Query: 244 GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPD 303
           G FP+Y++V+P + DK L  NC  L+QA  R +I+S+ + + V++ LS ++L +T +NP+
Sbjct: 188 GRFPDYRHVLPKNPDKTLEANCDMLKQAFSRAAILSNEKFRGVRIYLSENQLRITANNPE 247

Query: 304 MGKAIESMNVYYNECPMDICFNYKYLLEI 332
             +A E ++V Y    M+I FN  Y+L++
Sbjct: 248 QEEAEEIVDVSYQGTEMEIGFNVSYVLDV 276


>gi|268628263|gb|ACZ13530.1| DNA polymerase III beta chain [Xenorhabdus kozodoii]
 gi|268628265|gb|ACZ13531.1| DNA polymerase III beta chain [Xenorhabdus kozodoii]
          Length = 276

 Score =  196 bits (497), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 164/269 (60%), Gaps = 8/269 (2%)

Query: 65  GSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTKE 123
           G+ TV A   +DI R L DGA+IS     EL G  + +  G S F L + P S+FP+  +
Sbjct: 15  GATTVPARKFFDIWRGLPDGAEISV----ELDGDRILVRSGRSRFSLSTLPASDFPNLDD 70

Query: 124 EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAV 183
            +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   +ATDGHRLAV
Sbjct: 71  WQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TIATDGHRLAV 128

Query: 184 AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID 243
             ++I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++   + + +L+D
Sbjct: 129 CSMNI-GQNLPSHSVIVPRKGVIELMRLLDGGDNPLQLQIGSNNIRAHVGDFTFTSKLVD 187

Query: 244 GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPD 303
           G FP+Y+ V+P + DK L  NC  L+QA  R +I+S+ + + V++ LS ++L +T +NP+
Sbjct: 188 GRFPDYRRVLPKNPDKILEANCDMLKQAFSRAAILSNEKFRGVRIYLSENQLRITANNPE 247

Query: 304 MGKAIESMNVYYNECPMDICFNYKYLLEI 332
             +A E ++V Y    M+I FN  Y+L++
Sbjct: 248 QEEAEEIVDVSYPGTEMEIGFNVSYILDV 276


>gi|268628319|gb|ACZ13558.1| DNA polymerase III beta chain [Xenorhabdus budapestensis]
 gi|268628321|gb|ACZ13559.1| DNA polymerase III beta chain [Xenorhabdus budapestensis]
          Length = 276

 Score =  196 bits (497), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 163/269 (60%), Gaps = 8/269 (2%)

Query: 65  GSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTKE 123
           G+ T+ A   +DI R L DGA+IS     EL G  + +  G S F L + P S+FP+  +
Sbjct: 15  GATTIPARKFFDIWRGLPDGAEISV----ELDGDRILVRSGRSRFSLSTLPASDFPNLDD 70

Query: 124 EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAV 183
            +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGHRLAV
Sbjct: 71  WQSEVEFPLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGHRLAV 128

Query: 184 AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID 243
             + I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + +L+D
Sbjct: 129 CSMHI-GQSLPSHSVIVPRKGVIELMRLLDGGDTPLQLQIGSNNIRAHVGDFIFTSKLVD 187

Query: 244 GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPD 303
           G FP+Y+ V+P + DK L  NC  L+QA  R +I+S+ + + V++ LS ++L +T +NP+
Sbjct: 188 GRFPDYRRVLPKNPDKTLEANCDMLKQAFSRAAILSNEKFRGVRIYLSENQLRITANNPE 247

Query: 304 MGKAIESMNVYYNECPMDICFNYKYLLEI 332
             +A E ++V Y+   M+I FN  Y+L++
Sbjct: 248 QEEAEEIVDVKYHGTEMEIGFNVSYVLDV 276


>gi|319639359|ref|ZP_07994110.1| DNA polymerase III [Neisseria mucosa C102]
 gi|317399543|gb|EFV80213.1| DNA polymerase III [Neisseria mucosa C102]
          Length = 367

 Score =  196 bits (497), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 122/385 (31%), Positives = 210/385 (54%), Gaps = 23/385 (5%)

Query: 3   ITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPASVD 62
           +  +R  +L+ L     I+ER++T+P+  +VLL++ DG  ++ A+  EI+I  A P S  
Sbjct: 4   LQADRDSLLKPLQAVTGIVERRHTLPILSNVLLESKDGQTKLLATDLEIQINTAGPESQA 63

Query: 63  VCGSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESEFP-S 120
               IT +A    DI+R L D A +S  + +N L     +  G S F LQ+ P  +FP  
Sbjct: 64  GDFRITTNAKKFQDILRALPDSALVSLDWADNRL----TLRAGKSRFALQTLPAEDFPLM 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
           +   +   +F L     K ++ +  ++MA ++IRYYLNG+   +    L+L  VATDGHR
Sbjct: 120 SVGNDVSATFSLTQETFKTMLSQVQYSMAVQDIRYYLNGLLMQVEGNQLRL--VATDGHR 177

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LA A   I A++ K   +I+PRK V E+ ++L++   S+ V L ++++       ++  +
Sbjct: 178 LAYAASQIEAELPKT-EVILPRKTVLELFKLLNNPSESITVELLDNQVRFQCNGTTIVSK 236

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           +IDG+FP++  VIP  NDK   V+ T L  A++R +I+++ + +  +L L    L +   
Sbjct: 237 VIDGKFPDFNRVIPLDNDKIFLVSRTQLLGALERAAILANEKFRGARLFLQPGLLSVVCS 296

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           N +  +A E + + Y    +++ FN  YL++++ NI SD   D ++ F  D++ S++F  
Sbjct: 297 NNEQEEAREELEIAYQGGELEVGFNIGYLMDVLRNIHSD---DMQLAFG-DANRSTLF-- 350

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
                      N  N  Y++MPMRI
Sbjct: 351 --------TMPNNPNFKYIVMPMRI 367


>gi|268628273|gb|ACZ13535.1| DNA polymerase III beta chain [Xenorhabdus doucetiae]
          Length = 276

 Score =  196 bits (497), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 100/268 (37%), Positives = 163/268 (60%), Gaps = 6/268 (2%)

Query: 65  GSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPSTKEE 124
           G+ TV A   +DI R L DGA+IS  ++   G  + +  G S F L + P S+FP+  + 
Sbjct: 15  GATTVPARKFFDIWRGLPDGAEISVEQD---GDRILVRSGRSRFSLSTLPASDFPNLDDW 71

Query: 125 EYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAVA 184
           +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGHRLAV 
Sbjct: 72  QSEVEFTLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGHRLAVC 129

Query: 185 EVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLIDG 244
            ++I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + +L+DG
Sbjct: 130 SMNI-GQNLPSHSVIVPRKGVIELMRLLDGGDNPLQLQIGSNNIRAHVGDFIFTSKLVDG 188

Query: 245 EFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPDM 304
            FP+Y+ V+P + +K L  NC  L+QA  R +I+S+ + + V++ LS ++L +T +NP+ 
Sbjct: 189 RFPDYRRVLPKNPNKTLEANCDMLKQAFSRAAILSNEKFRGVRIYLSENQLRITANNPEQ 248

Query: 305 GKAIESMNVYYNECPMDICFNYKYLLEI 332
            +A E ++V Y    M+I FN  Y+L++
Sbjct: 249 EEAEEIVDVSYQGAEMEIGFNVSYVLDV 276


>gi|225077252|ref|ZP_03720451.1| hypothetical protein NEIFLAOT_02307 [Neisseria flavescens
           NRL30031/H210]
 gi|224951396|gb|EEG32605.1| hypothetical protein NEIFLAOT_02307 [Neisseria flavescens
           NRL30031/H210]
          Length = 367

 Score =  195 bits (496), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 122/385 (31%), Positives = 209/385 (54%), Gaps = 23/385 (5%)

Query: 3   ITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPASVD 62
           +  +R  +L+ L     I+ER++T+P+  +VLL++ DG  ++ A+  EI+I  A P S  
Sbjct: 4   LQADRDSLLKPLQAVTGIVERRHTLPILSNVLLESKDGQTKLLATDLEIQINTAGPESQA 63

Query: 63  VCGSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESEFPST 121
               IT +A    DI+R L D A +S  + +N L     +  G S F LQ+ P  +FP  
Sbjct: 64  GDFRITTNAKKFQDILRALPDSALVSLDWADNRL----TLRAGKSRFALQTLPAEDFPLM 119

Query: 122 K-EEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
               +   +F L     K ++ +  ++MA ++IRYYLNG+   +    L+L  VATDGHR
Sbjct: 120 NVGSDVSATFSLTQETFKTMLSQVQYSMAVQDIRYYLNGLLMQVEGNQLRL--VATDGHR 177

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LA A   I A++ K   +I+PRK V E+ ++L++   S+ V L ++++       ++  +
Sbjct: 178 LAYAASQIEAELPKT-EVILPRKTVLELFKLLNNPSESITVELLDNQVRFQCNGTTIVSK 236

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           +IDG+FP++  VIP  NDK   V+ T L  A++R +I+++ + +  +L L    L +   
Sbjct: 237 VIDGKFPDFNRVIPLDNDKIFLVSRTQLLGALERAAILANEKFRGARLFLQPGLLSVVCS 296

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           N +  +A E + + Y    +++ FN  YL++++ NI SD   D ++ F  D++ S++F  
Sbjct: 297 NNEQEEAREELEIAYQGGELEVGFNIGYLMDVLRNIHSD---DMQLAFG-DANRSTLF-- 350

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
                      N  N  Y++MPMRI
Sbjct: 351 --------TMPNNPNFKYIVMPMRI 367


>gi|268628373|gb|ACZ13585.1| DNA polymerase III beta chain [Photorhabdus luminescens subsp.
           luminescens]
 gi|268628375|gb|ACZ13586.1| DNA polymerase III beta chain [Photorhabdus luminescens subsp.
           luminescens]
          Length = 276

 Score =  195 bits (496), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 101/270 (37%), Positives = 162/270 (60%), Gaps = 8/270 (2%)

Query: 64  CGSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTK 122
            G+ TV A   +DI R L DGA+IS     EL G  + +  G S F L + P ++FP+  
Sbjct: 14  AGATTVPARKFFDIWRGLPDGAEISV----ELDGDRLLVRSGRSRFSLSTLPAADFPNLD 69

Query: 123 EEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLA 182
           + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGHRLA
Sbjct: 70  DWQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGHRLA 127

Query: 183 VAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLI 242
           V  + I  ++    S+IVPRK V E++R+L   D+ +++ +  + I  ++     + +L+
Sbjct: 128 VCSMGIGQKLPSH-SVIVPRKGVIELMRLLDGGDTPLQLQIGSNNIRAHVGDFIFTSKLV 186

Query: 243 DGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNP 302
           DG FP+Y+ V+P + DK L  NC  L+QA  R +I+S+ + + V+L  S ++L +T +NP
Sbjct: 187 DGRFPDYRRVLPKNPDKTLEANCDMLKQAFSRAAILSNEKFRGVRLYFSENQLKITANNP 246

Query: 303 DMGKAIESMNVYYNECPMDICFNYKYLLEI 332
           +  +A E ++V Y    M+I FN  Y+L++
Sbjct: 247 EQEEAEEIVDVSYQGAEMEIGFNVSYVLDV 276


>gi|261868624|ref|YP_003256546.1| DNA polymerase III subunit beta [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261413956|gb|ACX83327.1| DNA polymerase III, beta subunit [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 367

 Score =  195 bits (496), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 117/386 (30%), Positives = 206/386 (53%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPA- 59
           M+  + R ++L+ L   C ++  +  IPV  +VLLQ  +  L I  +  E+E++   P  
Sbjct: 2   MQFIISRENLLKPLQQVCGVLNSRPNIPVLNNVLLQIENNQLNITGTDLEVELSTQTPLL 61

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
             +  G  T+ A    DI R L D A+I+   E +      +    S F L + P  ++P
Sbjct: 62  HAEQDGKFTIPAKKFLDICRSLPDNAEIAVTFEEDRAI---VRSDRSKFNLSTLPAEDYP 118

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + L+ L+E T F+MA ++ RY+LNG+ F      L+   VATDGH
Sbjct: 119 NLTDWQSEVDFTLEQATLRRLIEATQFSMANQDARYFLNGMKFETEGNLLR--TVATDGH 176

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + +  Q  +  S+I+PRK V E+ R+L   D   ++ +  + + + + +++ + 
Sbjct: 177 RLAVCTIPL-EQDLQTHSVILPRKGVLELARLLEPSDQPARLQIGTNNLRIQLNNITFTS 235

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +LIDG FP+Y+ V+P +  + +      L+QA  R +I+S+ R ++V+L LS ++L +T 
Sbjct: 236 KLIDGRFPDYRRVLPRNATRIVEAGWETLKQAFVRAAILSNERFRSVRLQLSENQLKITA 295

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
            NP+   A E ++V Y+   M++ FN  Y+L++++ +       ++V  RL  ++SS  I
Sbjct: 296 TNPEQEVAEEIIDVSYSGEEMEVGFNVSYILDVLNALKC-----NQVRMRLTDASSSCLI 350

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              +  S         A YV+MPMR+
Sbjct: 351 EDCEDAS---------AEYVIMPMRL 367


>gi|241759458|ref|ZP_04757562.1| DNA polymerase III, beta subunit [Neisseria flavescens SK114]
 gi|241320240|gb|EER56573.1| DNA polymerase III, beta subunit [Neisseria flavescens SK114]
          Length = 367

 Score =  195 bits (496), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 123/385 (31%), Positives = 212/385 (55%), Gaps = 23/385 (5%)

Query: 3   ITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPASVD 62
           +  +R  +L+ L     I+ER++T+P+  +VLL++ DG  ++ A+  EI+I  A P S  
Sbjct: 4   LQADRDSLLKPLQAVTGIVERRHTLPILSNVLLESKDGQTKLLATDLEIQINTAGPESQA 63

Query: 63  VCGSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESEFP-S 120
               IT +A    DI+R L D A +S  + +N L     +  G S F LQ+ P  +FP  
Sbjct: 64  GDFRITTNAKKFQDILRALPDSALVSLDWADNRL----TLRAGKSRFALQTLPAEDFPLM 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
           +   +   +F L     K ++ +  ++MA ++IRYYLNG+   +    L+L  VATDGHR
Sbjct: 120 SVGSDVSATFSLTQETFKTMLSQVQYSMAVQDIRYYLNGLLMQVEGNQLRL--VATDGHR 177

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LA A   I A++ K   +I+PRK V E+ ++L++   S+ V L ++++       ++  +
Sbjct: 178 LAYAASQIEAELPKT-EVILPRKTVLELFKLLNNPSESITVELLDNQVRFQCNGTTIVSK 236

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           +IDG+FP++  VIP  NDK   V+ T L  A++R +I+++ + +  +L L    L +   
Sbjct: 237 VIDGKFPDFNRVIPLDNDKIFLVSRTQLLGALERAAILANEKFRGARLFLQPGLLSVVCS 296

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           N +  +A E + + Y    +++ FN  YL++++ NI SD   D ++ F  D++ S++F  
Sbjct: 297 NNEQEEAREELEIAYQGGELEVGFNIGYLMDVLRNIHSD---DMQLAFG-DANRSTLFT- 351

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
                  NN + K    Y++MPMRI
Sbjct: 352 -----VPNNPNFK----YIVMPMRI 367


>gi|58700013|ref|ZP_00374572.1| DNA polymerase III, beta subunit [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|58533470|gb|EAL57910.1| DNA polymerase III, beta subunit [Wolbachia endosymbiont of
           Drosophila ananassae]
          Length = 332

 Score =  195 bits (496), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 117/336 (34%), Positives = 200/336 (59%), Gaps = 5/336 (1%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ +V R+ +L  L     ++ER+N+I V   + ++A  G +++ A+  +I +  ++ A+
Sbjct: 1   MRFSVSRTSLLNTLSRVSGVVERRNSIDVLACINIKAQHGSIKLMATDLDISMFASLAAT 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V   G + +SAH L+DIV+KL     ++F   N+   ++ +S G++NF L +   S FP+
Sbjct: 61  VLTEGEVKISAHTLHDIVKKLPADLDVNFEVNNQ--GKLLMSCGNANFSLPNVVSSSFPA 118

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
            +E+ Y + F L ++ L +L+ +T FA++ ++ RY LNGI+ H +E+   L  VATDGHR
Sbjct: 119 LEEDNYKHDFILLNTDLIDLLTKTKFAVSLDDTRYNLNGIYLHTDEQ--FLYCVATDGHR 176

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           L+  +      I     +I+PRK V E+L+IL   +  +KV LS+ +I L      +  +
Sbjct: 177 LSCIKRPKPGNINGEFGVIIPRKTVMELLKILDDCNE-IKVKLSDRKIKLTCGEYILISK 235

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDG FPNY+ VIP S DK + +    L   +DRVS++ S +++++K SL    L +  +
Sbjct: 236 LIDGTFPNYKAVIPASQDKHMIIESKKLSDVIDRVSVVVSDKVKSIKFSLQEKLLTLHSN 295

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNI 336
           + +   A ES+ V YNE P++I FN +YLL+++  I
Sbjct: 296 SQECSDATESIEVDYNEAPIEIGFNSRYLLDVLSCI 331


>gi|167854884|ref|ZP_02477660.1| DNA polymerase III subunit beta [Haemophilus parasuis 29755]
 gi|167853951|gb|EDS25189.1| DNA polymerase III subunit beta [Haemophilus parasuis 29755]
          Length = 367

 Score =  195 bits (496), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 122/388 (31%), Positives = 215/388 (55%), Gaps = 24/388 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEIT--GAIP 58
           M+ T+ R  +L+ L   C ++  + T+PV  ++LL+     L +  +  E+E+T    + 
Sbjct: 1   MQFTITREQLLKPLQQVCGVLTSRPTLPVINNILLEIEGSRLSLTGTDLEVELTTQAELF 60

Query: 59  ASVDVCGSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESE 117
            +V   G  T+ A    DI R L D + IS  F E+     V I    S F L + P S+
Sbjct: 61  EAVSFSGKFTIPAKKFLDICRSLPDDSVISVQFDEDR----VFIRADRSKFNLATLPASD 116

Query: 118 FPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATD 177
           +PS  + +    F +  + L  L+E T F+MA ++ RY+LNG+ F      L+  +VATD
Sbjct: 117 YPSLMDWKPEVDFTIEQATLARLIEATQFSMANQDARYFLNGMKFETEGNLLR--SVATD 174

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLAV  + +  ++    S+IVPRKAV E++R++   + SV++ +  S + +++  +  
Sbjct: 175 GHRLAVCTMALNQELLTH-SVIVPRKAVLELVRLVGHNNESVRLEIGTSNLRVSMNGIVF 233

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +LIDG FP+Y+ V+P + D+ L  +   L++A+ R +I+S+ R + V+L+L+ + L +
Sbjct: 234 TSKLIDGRFPDYRRVLPRNADRILEADAEVLKRALVRAAILSNERFRGVRLALNQNLLKI 293

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           T +NP+  +A E ++V Y    M++ FN  YLL++++ +    V     +  +D+S+S +
Sbjct: 294 TANNPEQEEAEEIIDVSYQSAEMEVGFNVSYLLDVLNTLKCQRV----RISLVDASSSCL 349

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
                 +D  N       A YV+MPMR+
Sbjct: 350 I-----EDCDN-----ATAEYVIMPMRL 367


>gi|261380782|ref|ZP_05985355.1| DNA polymerase III, beta subunit [Neisseria subflava NJ9703]
 gi|284796246|gb|EFC51593.1| DNA polymerase III, beta subunit [Neisseria subflava NJ9703]
          Length = 367

 Score =  195 bits (496), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 123/385 (31%), Positives = 211/385 (54%), Gaps = 23/385 (5%)

Query: 3   ITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPASVD 62
           +  +R  +L+ L     I+ER++T+P+  +VLL++ DG  ++ A+  EI+I  A P S  
Sbjct: 4   LQADRDSLLKPLQAVTGIVERRHTLPILSNVLLESKDGQTKLLATDLEIQINTAGPESQA 63

Query: 63  VCGSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESEFPST 121
               IT +A    DI+R L D A +S  + +N L     +  G S F LQ+ P  +FP  
Sbjct: 64  GDFRITTNAKKFQDILRALPDSALVSLDWADNRL----TLRAGKSRFALQTLPAEDFPLM 119

Query: 122 K-EEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
               +   +F L     K ++ +  ++MA ++IRYYLNG+   +    L+L  VATDGHR
Sbjct: 120 NVGSDVSATFSLTQETFKTMLSQVQYSMAVQDIRYYLNGLLMQVEGNQLRL--VATDGHR 177

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LA A   I A++ K   +I+PRK V E+ ++L++   S+ V L ++++       ++  +
Sbjct: 178 LAYAASQIEAELPKT-EVILPRKTVLELFKLLNNPSESITVELLDNQVRFQCNGTTIVSK 236

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           +IDG+FP++  VIP  NDK   V+ T L  A++R +I+++ + +  +L L    L +   
Sbjct: 237 VIDGKFPDFNRVIPLDNDKIFLVSRTQLLGALERAAILANEKFRGARLFLQPGLLSVVCS 296

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           N +  +A E + + Y    +++ FN  YL++++ NI SD   D ++ F  D++ S++F  
Sbjct: 297 NNEQEEAREELEIAYQGGELEVGFNIGYLMDVLRNIHSD---DMQLAFG-DANRSTLFT- 351

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
                  NN + K    Y++MPMRI
Sbjct: 352 -----VPNNPNFK----YIVMPMRI 367


>gi|52424541|ref|YP_087678.1| DNA polymerase III subunit beta [Mannheimia succiniciproducens
           MBEL55E]
 gi|52306593|gb|AAU37093.1| DnaN protein [Mannheimia succiniciproducens MBEL55E]
          Length = 370

 Score =  195 bits (496), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 120/385 (31%), Positives = 205/385 (53%), Gaps = 20/385 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+  V R ++L+ L   C ++  +  IPV  +VLLQ  D  L I  +  E+E++      
Sbjct: 6   MQFIVSRDNLLKPLQQVCGVLSSRPNIPVLNNVLLQIADDCLTITGTDLEVELSTQAKLI 65

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
               G  T+ A    DI R L D A+I    E E      +    + F L + P  E+P+
Sbjct: 66  SGTEGKFTIPAKKFLDICRSLPDEAEIHVTFEEERAI---VRSARTKFNLATLPAEEYPN 122

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
             + +    F    + L+ L+E T F+MA ++ RY+LNG+ F      L+   VATDGHR
Sbjct: 123 LADWQSEVDFTTEQATLRRLIEATQFSMANQDARYFLNGMKFETEGNLLR--TVATDGHR 180

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LAV  + +  Q  +  S+IVPRK V E+ R+L + D+  ++ +  + + + + ++  + +
Sbjct: 181 LAVCTIAL-EQDLQNHSVIVPRKGVLELARLLEATDAPARLQIGTNNLRVQLANVVFTSK 239

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           LIDG FP+Y+ V+P + D  L  +   L+QA  R +I+S+ R ++V+L L  +++ +T  
Sbjct: 240 LIDGRFPDYRRVLPRNADHILEADWDVLKQAFVRAAILSTERFRSVRLQLDQNQMKITAT 299

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           NP+  +A E ++V Y+   M++ FN  Y+L++++ +         V  RL  ++SS  I 
Sbjct: 300 NPEQEEAEEIIDVSYSGNEMEVGFNVSYILDVLNALKC-----QRVRMRLTDASSSCLI- 353

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
                 +N +D   +A YV+MPMR+
Sbjct: 354 ------ENCED--ASAEYVIMPMRL 370


>gi|229843948|ref|ZP_04464089.1| DNA polymerase III subunit beta [Haemophilus influenzae 6P18H1]
 gi|229812942|gb|EEP48630.1| DNA polymerase III subunit beta [Haemophilus influenzae 6P18H1]
          Length = 366

 Score =  195 bits (496), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 121/386 (31%), Positives = 215/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ ++ R ++L+ L   C ++  +  IPV  +VLLQ  D  L I  +  E+E++     S
Sbjct: 1   MQFSISRENLLKPLQQVCGVLSNRPNIPVLNNVLLQIEDNRLTITGTDLEVELSSQTQLS 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ T+ A    DI R L D ++I+   E +      +  G S F L + P  E+P
Sbjct: 61  SSSENGTFTIPAKKFLDICRTLSDDSEITVTFEQDRAL---VQSGRSRFTLTTQPAEEYP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F+L  + L+ L+E T F+MA ++ RY+LNG+ F      L+   VATDGH
Sbjct: 118 NLTDWQSEVDFQLPQNTLRRLIESTQFSMANQDARYFLNGMKFETEGNLLR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + +  ++    S+I+PRK V E++R+L + D   ++ +  + + +++++   + 
Sbjct: 176 RLAVCTISLEQELQNH-SVILPRKGVLELVRLLETNDEPARLQIGTNNLRVHLKNTVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +LIDG FP+Y+ V+P +  K +  N   L+QA  R SI+S+ R ++V+LSL  ++L +T 
Sbjct: 235 KLIDGRFPDYRRVLPRNATKIVEGNWEMLKQAFVRASILSNERARSVRLSLKENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
            N +  +A E ++V YN   +++ FN  Y+L++++ +       ++V  RL  + SS  I
Sbjct: 295 SNTEHEEAEEIVDVNYNGEELEVGFNVTYILDVLNALKC-----NQVRMRLTDAFSSCLI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
                  +N +DN  ++ YV+MPMR+
Sbjct: 350 -------ENCEDN--SSEYVIMPMRL 366


>gi|219871633|ref|YP_002476008.1| DNA polymerase III subunit beta [Haemophilus parasuis SH0165]
 gi|219691837|gb|ACL33060.1| DNA polymerase III subunit beta [Haemophilus parasuis SH0165]
          Length = 367

 Score =  195 bits (496), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 122/388 (31%), Positives = 214/388 (55%), Gaps = 24/388 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEIT--GAIP 58
           M+ T+ R  +L+ L   C ++  + T+PV  ++LL+     L +  +  E+E+T    + 
Sbjct: 1   MQFTITREQLLKPLQQVCGVLTSRPTLPVINNILLEIEGSRLSLTGTDLEVELTTQAELF 60

Query: 59  ASVDVCGSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESE 117
            +V   G  T+ A    DI R L D + IS  F E+     V I    S F L + P S+
Sbjct: 61  EAVSFSGKFTIPAKKFLDICRSLPDDSVISVQFDEDR----VFIRADRSKFNLATLPASD 116

Query: 118 FPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATD 177
           +PS  + +    F +  + L  L+E T F+MA ++ RY+LNG+ F      L+  +VATD
Sbjct: 117 YPSLMDWKPEVDFTIEQATLARLIEATQFSMANQDARYFLNGMKFETEGNLLR--SVATD 174

Query: 178 GHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSM 237
           GHRLAV  + +  ++    S+IVPRKAV E++R++   + SV++ +  S + +++  +  
Sbjct: 175 GHRLAVCTMALNQELLTH-SVIVPRKAVLELVRLVGHNNESVRLEIGTSNLRVSMNGIVF 233

Query: 238 SVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCM 297
           + +LIDG FP+Y+ V+P + D+ L  +   L+ A+ R +I+S+ R + V+L+L+ + L +
Sbjct: 234 TSKLIDGRFPDYRRVLPRNADRILEADAEVLKHALVRAAILSNERFRGVRLALNQNLLKI 293

Query: 298 TVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSV 357
           T +NP+  +A E ++V Y    M++ FN  YLL++++ +    V     +  +D+S+S +
Sbjct: 294 TANNPEQEEAEEIIDVSYQSAEMEVGFNVSYLLDVLNTLKCQRV----RISLVDASSSCL 349

Query: 358 FIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
                 +D  N       A YV+MPMR+
Sbjct: 350 I-----EDCDN-----ATAEYVIMPMRL 367


>gi|268628289|gb|ACZ13543.1| DNA polymerase III beta chain [Xenorhabdus szentirmaii]
          Length = 276

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 162/269 (60%), Gaps = 8/269 (2%)

Query: 65  GSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTKE 123
           G+ T+ A   +DI R L DGA+IS     EL G  + +  G S F L + P S+FP+  +
Sbjct: 15  GATTIPARKFFDIWRGLPDGAEISV----ELDGDRILVRSGRSRFSLSTLPASDFPNLDD 70

Query: 124 EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAV 183
            +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGHRLAV
Sbjct: 71  WQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGHRLAV 128

Query: 184 AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID 243
             + I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + +L+D
Sbjct: 129 CSMGI-GQNLPSHSVIVPRKGVIELMRLLDGGDNPLQLQIGSNNIRAHVGDFIFTSKLVD 187

Query: 244 GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPD 303
           G FP+Y+ V+P + DK L  NC  L+QA  R +I+S+ + + V++ LS ++L +T +NP+
Sbjct: 188 GRFPDYRRVLPKNPDKTLVANCDTLKQAFSRAAILSNEKFRGVRIYLSENQLRITANNPE 247

Query: 304 MGKAIESMNVYYNECPMDICFNYKYLLEI 332
             +A E ++V Y    M+I FN  Y+L++
Sbjct: 248 QEEAEEIVDVSYQGTEMEIGFNVSYVLDV 276


>gi|145640666|ref|ZP_01796249.1| DNA polymerase III subunit beta [Haemophilus influenzae R3021]
 gi|145274592|gb|EDK14455.1| DNA polymerase III subunit beta [Haemophilus influenzae 22.4-21]
          Length = 366

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 120/386 (31%), Positives = 210/386 (54%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ ++ R ++L+ L   C ++  +  IPV  +VLLQ  D  L I  +  E+E++     S
Sbjct: 1   MQFSISRENLLKPLQQVCGVLSNRPNIPVLNNVLLQIEDNRLTITGTDLEVELSSQTQLS 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ T+ A    DI R L D ++I+   E +      +  G S F L + P  E+P
Sbjct: 61  SSSENGTFTIPAKKFLDICRTLSDDSEITVTFEQDRAL---VQSGRSRFTLTTQPAEEYP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    FEL  + L+ L+E T F+MA ++ RY+LNG+ F      L+   VATDGH
Sbjct: 118 NLTDWQSEVDFELPQNTLRRLIESTQFSMANQDARYFLNGMKFETEGNLLR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + +  ++    S+I+PRK V E++R+L + D   ++ +  + + +++++   + 
Sbjct: 176 RLAVCTISLEQELQNH-SVILPRKGVLELVRLLETNDEPARLQIGTNNLRVHLKNTVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +LIDG FP+Y+ V+P +  K +  N   L+QA  R SI+S+ R ++V+LSL  ++L +T 
Sbjct: 235 KLIDGRFPDYRRVLPRNATKIVEGNWEMLKQAFVRASILSNERARSVRLSLKENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
            N +  +A E ++V YN   +++ FN  Y+L++++ +       ++V  RL  + SS  I
Sbjct: 295 SNTEHEEAEEIVDVNYNGEELEVGFNVTYILDVLNALKC-----NQVRMRLTDAFSSCLI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              +  S           YV+MPMR+
Sbjct: 350 ENCEDSSSE---------YVIMPMRL 366


>gi|167010109|ref|ZP_02275040.1| DNA polymerase III, beta subunit [Francisella tularensis subsp.
           holarctica FSC200]
          Length = 344

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 121/366 (33%), Positives = 214/366 (58%), Gaps = 26/366 (7%)

Query: 24  KNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPASVDVCGSITVSAHLLYDIVRKLQD 83
           K+T+P+   +L   ++  L+I AS  + EI+  I  S +    + ++A  +Y+IVR L +
Sbjct: 1   KSTMPLLSCILFDIDNNNLKITASDLDTEISCNIAVSCNTTIKLALNADKIYNIVRSLNE 60

Query: 84  GAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP---STKEEEYVYSFELASSVLKNL 140
            + I F + NE   +V I   +S F L S     +P   S   E+   SF+L+     ++
Sbjct: 61  NSMIDF-RINE--NKVTIVSNNSTFNLISLNADNYPLIDSNINEQA--SFDLSQQDFHHI 115

Query: 141 VERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAVAEVDIVAQIAKMPS-II 199
           + +  F+MA ++ RY+LNG+F+ IN   L+  AV+TDGHR+++ E  I +++    S  I
Sbjct: 116 ISKVDFSMANDDTRYFLNGMFWEINANLLR--AVSTDGHRMSITEAIIDSKVLDSASQSI 173

Query: 200 VPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLIDGEFPNYQNVIPCSNDK 259
           +P+KA+ E+ +I+   + ++K+ L ++ +     + +   +LIDG +P+YQ VIP +N K
Sbjct: 174 IPKKAILELKKIVGKTEENIKICLGKNYLKAIFGNYAFISKLIDGRYPDYQKVIPKNNTK 233

Query: 260 ELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPDMGKAIESMNVYYNECP 319
            L V+    + ++ R SI+++ + + V+L++S ++L ++ +NPD  KA + + V YN+ P
Sbjct: 234 LLAVDKQFFKNSLLRTSILANDKYKGVRLNISQNQLLLSANNPDNEKAEDKIEVQYNDQP 293

Query: 320 MDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIRGKDKDSKNNKDNKVNAFYV 379
           M+ICFNYKYLL+II N+ S+E +       LD+ N S  +          KD K N+ ++
Sbjct: 294 MEICFNYKYLLDII-NVLSEETMS----IYLDNPNMSALV----------KDEKDNSLFI 338

Query: 380 LMPMRI 385
           +MPM+I
Sbjct: 339 IMPMKI 344


>gi|268628369|gb|ACZ13583.1| DNA polymerase III beta chain [Photorhabdus luminescens subsp.
           caribbeanensis]
 gi|268628371|gb|ACZ13584.1| DNA polymerase III beta chain [Photorhabdus luminescens subsp.
           caribbeanensis]
          Length = 276

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 101/270 (37%), Positives = 162/270 (60%), Gaps = 8/270 (2%)

Query: 64  CGSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTK 122
            G+ TV A   +DI R L DGA+IS     EL G  + +  G S F L + P S+FP+  
Sbjct: 14  AGATTVPARKFFDIWRGLPDGAEISV----ELDGDRLLVRSGRSRFSLSTLPASDFPNLD 69

Query: 123 EEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLA 182
           + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGHRLA
Sbjct: 70  DWQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEAEELR--TVATDGHRLA 127

Query: 183 VAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLI 242
           V  + I  ++    S+IVPRK V E++R+L   D+ +++ +  + I  ++     + +L+
Sbjct: 128 VCSMGIGQKLPSH-SVIVPRKGVIELMRLLDGGDTPLQLQIGSNNIRAHVGDFIFTSKLV 186

Query: 243 DGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNP 302
           DG FP+Y+ V+P + DK L  +C  L+QA  R +I+S+ + + V+L  S ++L +T +NP
Sbjct: 187 DGRFPDYRRVLPKNPDKTLEASCDMLKQAFSRAAILSNEKFRGVRLYFSKNQLKITANNP 246

Query: 303 DMGKAIESMNVYYNECPMDICFNYKYLLEI 332
           +  +A E ++V Y    M+I FN  Y+L++
Sbjct: 247 EQEEAEEIVDVSYQGAEMEIGFNVSYVLDV 276


>gi|237747156|ref|ZP_04577636.1| DNA polymerase III subunit beta [Oxalobacter formigenes HOxBLS]
 gi|229378507|gb|EEO28598.1| DNA polymerase III subunit beta [Oxalobacter formigenes HOxBLS]
          Length = 368

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 120/381 (31%), Positives = 211/381 (55%), Gaps = 22/381 (5%)

Query: 7   RSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEI-TGAIPASVDVCG 65
           R ++L  L     I+ER++T+P+  ++L++     +   ++  EI+I T A   + +   
Sbjct: 8   RDNLLRPLQIVSGIVERRHTLPILANILIRKEGNAVSFLSTDTEIQIVTHAEIGTAEEDA 67

Query: 66  SITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPSTKEE- 124
           + TV+A  L DI+R L D A+I+    ++    + +S G S F LQ+ P ++FP+  +  
Sbjct: 68  TTTVAARKLLDILRALPDSAEIAISLNDK---RLVVSAGKSRFSLQTLPAADFPTVSQPL 124

Query: 125 EYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAVA 184
           EY  S  L+   LKNL+   +FAMA ++IRYYLNG+        +K  AVATDGHRLA  
Sbjct: 125 EYQTSVTLSQKSLKNLLGMVYFAMAQQDIRYYLNGLLLQTGGNTIK--AVATDGHRLAFC 182

Query: 185 EVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLIDG 244
           +++   + +    +I+PRK + E+ R+L   +  V++ +S +++      + +  +L++G
Sbjct: 183 QMETEQEFSN-NDVIIPRKTILELQRLLEESEEPVRIDISGAQVRFVFGDVELISKLVEG 241

Query: 245 EFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPDM 304
           +FP+Y  VIP     +  ++   L++A+ R +IM+S + + ++  L+   L ++  N D 
Sbjct: 242 KFPDYTRVIPKGYKNKFTISRELLQRALQRAAIMTSDKFKGIRCILAPGSLKISSTNADQ 301

Query: 305 GKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIRGKDK 364
            +AIE + + Y+   +DI FN  YLL+++ N+      +DE+   L  +NSS  +   D 
Sbjct: 302 EEAIEEIELDYDGDNIDIGFNVTYLLDVLGNLK-----NDEISIELGDANSSALMSVPD- 355

Query: 365 DSKNNKDNKVNAFYVLMPMRI 385
               N D K    YV+MPMRI
Sbjct: 356 ----NTDFK----YVVMPMRI 368


>gi|268628271|gb|ACZ13534.1| DNA polymerase III beta chain [Xenorhabdus griffiniae]
          Length = 276

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 163/269 (60%), Gaps = 8/269 (2%)

Query: 65  GSITVSAHLLYDIVRKLQDGAQISFFKENELGTE-VNISHGDSNFYLQSFPESEFPSTKE 123
           G+ TV A   +DI R L DGA+IS     EL ++ + +  G S F L + P S+FP+  +
Sbjct: 15  GATTVPARKFFDIWRGLPDGAEISV----ELDSDRILVRSGRSRFSLSTLPASDFPNLDD 70

Query: 124 EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAV 183
            +    F L  S LK L+E T F+MA +++RYYLNG+ F    E+L+   +ATDGHRLAV
Sbjct: 71  WQSEVEFSLPQSTLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TIATDGHRLAV 128

Query: 184 AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID 243
             + I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + +L+D
Sbjct: 129 CSMSI-GQDLPSHSVIVPRKGVIELMRLLDGGDNPLQLQIGSNNIRAHVGDFIFTSKLVD 187

Query: 244 GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPD 303
           G FP+Y+ V+P + DK L  NC  L+QA  R +I+S+ + + V++ LS ++L +T +NP+
Sbjct: 188 GRFPDYRRVLPKNPDKTLEANCDMLKQAFSRAAILSNEKFRGVRIYLSENQLRITANNPE 247

Query: 304 MGKAIESMNVYYNECPMDICFNYKYLLEI 332
             +A E ++V Y    M+I FN  Y+L++
Sbjct: 248 QEEAEEIVDVSYQGAEMEIGFNVSYILDV 276


>gi|261363924|ref|ZP_05976807.1| DNA polymerase III, beta subunit [Neisseria mucosa ATCC 25996]
 gi|288567936|gb|EFC89496.1| DNA polymerase III, beta subunit [Neisseria mucosa ATCC 25996]
          Length = 367

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 123/385 (31%), Positives = 212/385 (55%), Gaps = 23/385 (5%)

Query: 3   ITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPASVD 62
           +  +R  +L+ L     I+ER++T+P+  +VLL++ DG  ++ A+  EI+I  A P S  
Sbjct: 4   LQADRDSLLKPLQAVTGIVERRHTLPILSNVLLESKDGQTKLLATDLEIQINTAGPESQA 63

Query: 63  VCGSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESEFP-S 120
               IT +A    DI+R L D A +S  + +N L     +  G S F LQ+ P  +FP  
Sbjct: 64  GDFRITTNAKKFQDILRALPDSAIVSLDWADNRL----TLRAGKSRFALQTLPAEDFPLM 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
           +  E+   +F L+    K ++ +  ++MA ++IRYYLNG+   +    L+L  VATDGHR
Sbjct: 120 SVGEDISAAFSLSQETFKTMLSQVQYSMAVQDIRYYLNGLLMQVEGSQLRL--VATDGHR 177

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LA A   I A++ K   +I+PRK V E+ ++L++    + V L  +++       ++  +
Sbjct: 178 LAYAASQIEAELPKT-EVILPRKTVLELFKLLNNPSEPISVELLNNQVRFQCNGTTIVSK 236

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           +IDG+FP++  VIP  NDK   V+ T L  A++R +I+++ + +  +L L    L +   
Sbjct: 237 VIDGKFPDFNRVIPLDNDKIFLVSRTQLLGALERAAILANEKFRGARLFLQPGLLSVVCS 296

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           N +  +A E + + Y    +++ FN  YL++++ NI SD   D ++ F  D++ S++F  
Sbjct: 297 NNEQEEAREELEIAYQGGELEVGFNIGYLMDVLRNIHSD---DMQLAFG-DANRSTLFT- 351

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
                  NN + K    Y++MPMRI
Sbjct: 352 -----VPNNPNFK----YIVMPMRI 367


>gi|268628281|gb|ACZ13539.1| DNA polymerase III beta chain [Xenorhabdus poinarii]
 gi|268628283|gb|ACZ13540.1| DNA polymerase III beta chain [Xenorhabdus poinarii]
 gi|268628285|gb|ACZ13541.1| DNA polymerase III beta chain [Xenorhabdus poinarii]
          Length = 276

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 163/269 (60%), Gaps = 8/269 (2%)

Query: 65  GSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTKE 123
           G+ TV A   +DI R L DGA+IS     EL G  + +  G S F L + P S+FP+  +
Sbjct: 15  GATTVPARKFFDIWRGLPDGAEISV----ELDGDRILVRSGRSRFSLSTLPASDFPNLDD 70

Query: 124 EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAV 183
            +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGHRLAV
Sbjct: 71  WKSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGHRLAV 128

Query: 184 AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID 243
             ++I  Q     S+IVPRK V E++R+L   ++ +++ +  + I  ++     + +L+D
Sbjct: 129 CSMNI-GQNLPSHSVIVPRKGVIELMRLLDGGENPLQLQIGSNNIRAHVNDFIFTSKLVD 187

Query: 244 GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPD 303
           G FP+Y+ V+P + DK L  NC  L+QA  R +I+S+ + + V++ LS ++L +T +NP+
Sbjct: 188 GRFPDYRRVLPKNPDKTLEANCDMLKQAFSRAAILSNEKFRGVRIYLSENQLRITANNPE 247

Query: 304 MGKAIESMNVYYNECPMDICFNYKYLLEI 332
             +A E ++V Y    M+I FN  Y+L++
Sbjct: 248 QEEAEEILDVSYQGTEMEIGFNVSYVLDV 276


>gi|268628301|gb|ACZ13549.1| DNA polymerase III beta chain [Xenorhabdus mauleonii]
          Length = 276

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 101/269 (37%), Positives = 163/269 (60%), Gaps = 8/269 (2%)

Query: 65  GSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTKE 123
           G+ TV A   +DI R L DGA+IS     EL G  + +  G S F L + P ++FP+  +
Sbjct: 15  GATTVPARKFFDIWRGLPDGAEISV----ELDGDRILVRSGRSRFSLSTLPATDFPNLDD 70

Query: 124 EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAV 183
            +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGHRLAV
Sbjct: 71  WQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGHRLAV 128

Query: 184 AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID 243
             ++I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + +L+D
Sbjct: 129 CSMNI-GQTLPSHSVIVPRKGVIELMRLLDGGDNPLQLQIGSNNIRAHVGDFIFTSKLVD 187

Query: 244 GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPD 303
           G FP+Y+ V+P + DK L  NC  ++QA  R +I+S+ + + V++ LS ++L +T +NP+
Sbjct: 188 GRFPDYRRVLPKNPDKTLVANCDMIKQAFSRAAILSNEKFRGVRIYLSENQLRITANNPE 247

Query: 304 MGKAIESMNVYYNECPMDICFNYKYLLEI 332
             +A E ++V Y    M+I FN  Y+L++
Sbjct: 248 QEEAEEIVDVSYQGTEMEIGFNVSYVLDV 276


>gi|268628333|gb|ACZ13565.1| DNA polymerase III beta chain [Photorhabdus temperata subsp.
           tasmaniensis]
          Length = 276

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 102/270 (37%), Positives = 161/270 (59%), Gaps = 8/270 (2%)

Query: 64  CGSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTK 122
            G+ TV A   +DI R L DGA+IS     EL G  + +  G S F L + P ++FP+  
Sbjct: 14  AGATTVPARKFFDIWRGLPDGAEISL----ELDGDRLLVRSGRSRFSLSTLPAADFPNLD 69

Query: 123 EEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLA 182
           + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGHRLA
Sbjct: 70  DWQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGHRLA 127

Query: 183 VAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLI 242
           V  + I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + +L+
Sbjct: 128 VCSMGI-GQNLPSHSVIVPRKGVIELMRLLDGGDTPLQLQIGSNNIRAHVGDFIFTSKLV 186

Query: 243 DGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNP 302
           DG FP+Y+ V+P S DK L  +C  L+QA  R +I+S+ + + V+L  S ++L +T +NP
Sbjct: 187 DGRFPDYRRVLPKSPDKTLEASCDMLKQAFSRAAILSNEKFRGVRLYFSENQLKITANNP 246

Query: 303 DMGKAIESMNVYYNECPMDICFNYKYLLEI 332
           +  +A E ++V Y    M+I FN  Y+L++
Sbjct: 247 EQEEAEEIVDVSYQGTEMEIGFNVSYVLDV 276


>gi|290953774|ref|ZP_06558395.1| DNA polymerase III, beta subunit [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295312852|ref|ZP_06803583.1| DNA polymerase III, beta subunit [Francisella tularensis subsp.
           holarctica URFT1]
          Length = 351

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 121/366 (33%), Positives = 214/366 (58%), Gaps = 26/366 (7%)

Query: 24  KNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPASVDVCGSITVSAHLLYDIVRKLQD 83
           K+T+P+   +L   ++  L+I AS  + EI+  I  S +    + ++A  +Y+IVR L +
Sbjct: 8   KSTMPLLSCILFDIDNNNLKITASDLDTEISCNIAVSCNTTIKLALNADKIYNIVRSLNE 67

Query: 84  GAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP---STKEEEYVYSFELASSVLKNL 140
            + I F + NE   +V I   +S F L S     +P   S   E+   SF+L+     ++
Sbjct: 68  NSMIDF-RINE--NKVTIVSNNSTFNLISLNADNYPLIDSNINEQA--SFDLSQQDFHHI 122

Query: 141 VERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAVAEVDIVAQIAKMPS-II 199
           + +  F+MA ++ RY+LNG+F+ IN   L+  AV+TDGHR+++ E  I +++    S  I
Sbjct: 123 ISKVDFSMANDDTRYFLNGMFWEINANLLR--AVSTDGHRMSITEAIIDSKVLDSASQSI 180

Query: 200 VPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLIDGEFPNYQNVIPCSNDK 259
           +P+KA+ E+ +I+   + ++K+ L ++ +     + +   +LIDG +P+YQ VIP +N K
Sbjct: 181 IPKKAILELKKIVGKTEENIKICLGKNYLKAIFGNYAFISKLIDGRYPDYQKVIPKNNTK 240

Query: 260 ELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPDMGKAIESMNVYYNECP 319
            L V+    + ++ R SI+++ + + V+L++S ++L ++ +NPD  KA + + V YN+ P
Sbjct: 241 LLAVDKQFFKNSLLRTSILANDKYKGVRLNISQNQLLLSANNPDNEKAEDKIEVQYNDQP 300

Query: 320 MDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIRGKDKDSKNNKDNKVNAFYV 379
           M+ICFNYKYLL+II N+ S+E +       LD+ N S  +          KD K N+ ++
Sbjct: 301 MEICFNYKYLLDII-NVLSEETMS----IYLDNPNMSALV----------KDEKDNSLFI 345

Query: 380 LMPMRI 385
           +MPM+I
Sbjct: 346 IMPMKI 351


>gi|255066617|ref|ZP_05318472.1| DNA polymerase III, beta subunit [Neisseria sicca ATCC 29256]
 gi|255049201|gb|EET44665.1| DNA polymerase III, beta subunit [Neisseria sicca ATCC 29256]
          Length = 367

 Score =  194 bits (494), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 123/385 (31%), Positives = 212/385 (55%), Gaps = 23/385 (5%)

Query: 3   ITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPASVD 62
           +  +R  +L+ L     I+ER++T+P+  +VLL++ DG  ++ A+  EI+I  A P S  
Sbjct: 4   LQADRDSLLKPLQAVTGIVERRHTLPILSNVLLESKDGQTKLLATDLEIQINTAGPESQA 63

Query: 63  VCGSITVSAHLLYDIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESEFP-S 120
               IT +A    DI+R L D A +S  + +N L     +  G S F LQ+ P  +FP  
Sbjct: 64  GDFRITTNAKKFQDILRALPDSAIVSLDWADNRL----TLRAGKSRFALQTLPAEDFPLM 119

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
           +  E+   +F L+    K ++ +  ++MA ++IRYYLNG+   +    L+L  VATDGHR
Sbjct: 120 SVGEDISAAFSLSQETFKTMLSQVQYSMAVQDIRYYLNGLLMQVEGNQLRL--VATDGHR 177

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240
           LA A   I A++ K   +I+PRK V E+ ++L++    + V L  +++       ++  +
Sbjct: 178 LAYAASQIEAELPKT-EVILPRKTVLELFKLLNNPSEPISVELLNNQVRFQCNGTTIVSK 236

Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300
           +IDG+FP++  VIP  NDK   V+ T L  A++R +I+++ + +  +L L    L +   
Sbjct: 237 VIDGKFPDFNRVIPLDNDKIFLVSRTQLLGALERAAILANEKFRGARLFLQPGLLSVVCS 296

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
           N +  +A E + + Y    +++ FN  YL++++ NI SD   D ++ F  D++ S++F  
Sbjct: 297 NNEQEEAREELEIAYQGGELEVGFNIGYLMDVLRNIHSD---DMQLAFG-DANRSTLFT- 351

Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385
                  NN + K    Y++MPMRI
Sbjct: 352 -----VPNNPNFK----YIVMPMRI 367


>gi|268628323|gb|ACZ13560.1| DNA polymerase III beta chain [Xenorhabdus innexi]
 gi|268628325|gb|ACZ13561.1| DNA polymerase III beta chain [Xenorhabdus innexi]
          Length = 276

 Score =  194 bits (494), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 101/269 (37%), Positives = 163/269 (60%), Gaps = 8/269 (2%)

Query: 65  GSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTKE 123
           G+ T+ A   +DI R L DGA+IS     EL G  + +  G S F L + P S+FP+  +
Sbjct: 15  GATTIPARKFFDIWRGLPDGAEISV----ELDGDRILVRSGRSRFSLSTLPASDFPNLDD 70

Query: 124 EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAV 183
            +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   V+TDGHRLAV
Sbjct: 71  WQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVSTDGHRLAV 128

Query: 184 AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID 243
             ++I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + +L+D
Sbjct: 129 CSMNI-GQSLPSHSVIVPRKGVIELMRLLDGGDNPLQLQIGSNNIRAHVGDFIFTSKLVD 187

Query: 244 GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPD 303
           G FP+Y+ V+P + DK L  NC  L+QA  R +I+S+ + + V++ LS ++L +T +NP+
Sbjct: 188 GRFPDYRRVLPKNPDKILEANCDTLKQAFSRAAILSNEKFRGVRIYLSENQLRITANNPE 247

Query: 304 MGKAIESMNVYYNECPMDICFNYKYLLEI 332
             +A E ++V Y    M+I FN  Y+L++
Sbjct: 248 QEEAEEIVDVSYQGTEMEIGFNVSYVLDV 276


>gi|268628277|gb|ACZ13537.1| DNA polymerase III beta chain [Xenorhabdus vietnamensis]
          Length = 276

 Score =  194 bits (494), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 103/269 (38%), Positives = 162/269 (60%), Gaps = 8/269 (2%)

Query: 65  GSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTKE 123
           G+ TV A   +DI R L DGA+IS     EL G  + +  G S F L + P S+FP+  +
Sbjct: 15  GATTVPARKFFDIWRGLPDGAEISV----ELDGDRILVRSGRSRFSLSTLPASDFPNLDD 70

Query: 124 EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAV 183
            +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGHRLAV
Sbjct: 71  WQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGHRLAV 128

Query: 184 AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID 243
             + I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + +L+D
Sbjct: 129 CSMHI-GQNLPSHSVIVPRKGVIELMRLLDGGDNLLQLQIGSNNIRAHVGDFIFTSKLVD 187

Query: 244 GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPD 303
           G FP+Y+ V+P + DK L  NC  L+QA  R +I+S+ + + V++ LS ++L +T +NP+
Sbjct: 188 GRFPDYRRVLPKNPDKTLEANCDMLKQAFSRAAILSNEKFRGVRIYLSENQLRITANNPE 247

Query: 304 MGKAIESMNVYYNECPMDICFNYKYLLEI 332
             +A E ++V Y    M+I FN  Y+L++
Sbjct: 248 QEEAEEIVDVSYQGTEMEIGFNVSYVLDV 276


>gi|301169718|emb|CBW29319.1| DNA polymerase III, beta subunit [Haemophilus influenzae 10810]
          Length = 366

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 120/386 (31%), Positives = 210/386 (54%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ ++ R ++L+ L   C ++  +  IPV  +VLLQ  D  L I  +  E+E++     S
Sbjct: 1   MQFSISRENLLKPLQQVCGVLSNRPNIPVLNNVLLQIEDNRLTITGTDLEVELSSQTQLS 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ T+ A    DI R L D ++I+   E +      +  G S F L + P  E+P
Sbjct: 61  SSSENGTFTIPAKKFLDICRTLSDDSEITVTFEQDRAL---VQSGRSRFTLTTQPAEEYP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    FEL  + L+ L+E T F+MA ++ RY+LNG+ F      L+   VATDGH
Sbjct: 118 NLTDWQSEVDFELPQNTLRRLIESTQFSMANQDARYFLNGMKFETEGNLLR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + +  ++    S+I+PRK V E++R+L + D   ++ +  + + +++++   + 
Sbjct: 176 RLAVCTISLEQELQNH-SVILPRKGVLELVRLLETNDEPARLQIGTNNLRVHLKNTVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +LIDG FP+Y+ V+P +  K +  N   L+QA  R SI+S+ R ++V+LSL  ++L +T 
Sbjct: 235 KLIDGRFPDYRRVLPRNATKIVEGNWEMLKQAFVRASILSNERARSVRLSLKENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
            N +  +A E ++V YN   +++ FN  Y+L++++ +       ++V  RL  + SS  I
Sbjct: 295 SNTEHEEAEEIVDVNYNGEELEVGFNVTYILDVLNALKC-----NQVRMRLTDAFSSCLI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              +  S           YV+MPMR+
Sbjct: 350 ENCEDSS---------CEYVIMPMRL 366


>gi|268628329|gb|ACZ13563.1| DNA polymerase III beta chain [Photorhabdus temperata subsp.
           tasmaniensis]
 gi|268628331|gb|ACZ13564.1| DNA polymerase III beta chain [Photorhabdus temperata subsp.
           tasmaniensis]
          Length = 276

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 102/270 (37%), Positives = 161/270 (59%), Gaps = 8/270 (2%)

Query: 64  CGSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTK 122
            G+ TV A   +DI R L DGA+IS     EL G  + +  G S F L + P ++FP+  
Sbjct: 14  AGATTVPARKFFDIWRGLPDGAEISV----ELDGDRLLVRSGRSRFSLSTLPAADFPNLD 69

Query: 123 EEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLA 182
           + +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGHRLA
Sbjct: 70  DWQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGHRLA 127

Query: 183 VAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLI 242
           V  + I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + +L+
Sbjct: 128 VCSMGI-GQNLPSHSVIVPRKGVIELMRLLDGGDTPLQLQIGSNNIRAHVGDFIFTSKLV 186

Query: 243 DGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNP 302
           DG FP+Y+ V+P S DK L  +C  L+QA  R +I+S+ + + V+L  S ++L +T +NP
Sbjct: 187 DGRFPDYRRVLPKSPDKTLEASCDMLKQAFSRAAILSNEKFRGVRLYFSENQLKITANNP 246

Query: 303 DMGKAIESMNVYYNECPMDICFNYKYLLEI 332
           +  +A E ++V Y    M+I FN  Y+L++
Sbjct: 247 EQEEAEEIVDVSYQGTEMEIGFNVSYVLDV 276


>gi|68249577|ref|YP_248689.1| DNA polymerase III subunit beta [Haemophilus influenzae 86-028NP]
 gi|68057776|gb|AAX88029.1| DNA polymerase III, beta chain [Haemophilus influenzae 86-028NP]
          Length = 366

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 120/386 (31%), Positives = 213/386 (55%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+ ++ R ++L+ L   C ++  +  IPV  +VLLQ  D  L I  +  E+E++     S
Sbjct: 1   MQFSISRENLLKPLQQVCGVLSNRPNIPVLNNVLLQIEDNRLTITGTDLEVELSSQTQLS 60

Query: 61  VDV-CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ T+ A    DI R L D ++I+   E +      +  G S F L + P  E+P
Sbjct: 61  SSSENGTFTIPAKKFLDICRTLSDDSEITVTFEQDRAL---VQSGRSRFTLTTQPAEEYP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F+L  + L+ L+E T F+MA ++ RY+LNG+ F      L+   VATDGH
Sbjct: 118 NLTDWQSEVDFQLPQNTLRRLIEATQFSMANQDARYFLNGMKFETEGNLLR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + +  ++    S+I+PRK V E++R+L + D   ++ +  + + +++++   + 
Sbjct: 176 RLAVCTISLEQELQNH-SVILPRKGVLELVRLLETNDEPARLQIGTNNLRVHLKNTVFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +LIDG FP+Y+ V+P +  K +  N   L+QA  R SI+S+ R ++V+LSL  ++L +T 
Sbjct: 235 KLIDGRFPDYRRVLPRNATKTVEGNWEMLKQAFVRASILSNERARSVRLSLKENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
            N +  +A E ++V YN   +++ FN  Y+L++++ +       ++V  RL  + SS  I
Sbjct: 295 SNTEHEEAEEIVDVNYNGEELEVGFNVTYILDVLNALKC-----NQVRMRLTDAFSSCLI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
                  +N +D+     YV+MPMR+
Sbjct: 350 -------ENCEDSSCE--YVIMPMRL 366


>gi|153002881|ref|YP_001377206.1| DNA polymerase III subunit beta [Anaeromyxobacter sp. Fw109-5]
 gi|152026454|gb|ABS24222.1| DNA polymerase III, beta subunit [Anaeromyxobacter sp. Fw109-5]
          Length = 376

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 125/393 (31%), Positives = 210/393 (53%), Gaps = 25/393 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M++ +  +++ + LG +  I+E+K+T+P+  HVLL+A  G L + A+  ++ ++      
Sbjct: 1   MELKIGVAELAKALGRSQGIVEKKSTMPILSHVLLEAKGGHLVVSATDLDLAVSSEHGEH 60

Query: 61  VDVC--GSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEF 118
            +V   G++ VSA  LY+IVR L +  Q++  + +     + +  G S F +   P  +F
Sbjct: 61  CEVLKEGALAVSARHLYEIVRALPE-QQVTLKRAHN--NYLEVRSGPSEFRIVGLPAEDF 117

Query: 119 PSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDG 178
           P+    E V   ++    L +++ERT FA++ +E RY LNG++F    E L+L  VATDG
Sbjct: 118 PALPRFEKVTFSDVKPEDLLDMIERTFFAVSNDETRYNLNGVYFEPGPEVLRL--VATDG 175

Query: 179 HRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILS------SKDSSVKVSLSESRIHLNI 232
           HRL+++E  I         +I+P+K + E+ ++L       +     K+   E+      
Sbjct: 176 HRLSLSERSIGGTFGLKRGVILPKKGLHELRKLLGEAVEAGADAGETKLGFVENSAIFRR 235

Query: 233 ESLSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSS 292
             + +S+RLI+G FP+Y+ VIP   +K LR+      + + RVS++SS +  AVKL L  
Sbjct: 236 PGVILSMRLIEGLFPDYRQVIPKQGEKVLRLGRDRFLETLRRVSLLSSDKAHAVKLELGQ 295

Query: 293 DKLCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDS 352
             L +   NPD+G+A E + V Y   P+ I FN +YL++++  + S      EV   L  
Sbjct: 296 GTLKVLSQNPDLGEAKEEVPVEYAGEPLKIGFNARYLMDVLGVVKS-----AEVQLELAD 350

Query: 353 SNSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             S   +RG D+     KD    A  V+MPMRI
Sbjct: 351 DLSPGVMRGGDE-----KDAGFTA--VVMPMRI 376


>gi|117923320|ref|YP_863937.1| DNA polymerase III subunit beta [Magnetococcus sp. MC-1]
 gi|117607076|gb|ABK42531.1| DNA polymerase III, beta subunit [Magnetococcus sp. MC-1]
          Length = 376

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 123/393 (31%), Positives = 201/393 (51%), Gaps = 25/393 (6%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           M+  V R   L+ L     ++E++NT+P   + LL+A+   L + A+  E+ +    PA 
Sbjct: 1   MEFHVSREPFLKALQRLQSVVEKRNTMPELGNALLEASAEGLTLTATDLEVSMKSHCPAE 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V+  G+I VSA  L++IVR+L    Q S    +E G  + ++ G + F L       FP 
Sbjct: 61  VESSGAIAVSARKLFEIVREL---PQDSLRLRSEAGERLVLTCGRARFTLVGIRADIFPP 117

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFH-INEEDLKLCA------ 173
             E     SF L+   L  ++ +THFAM+ +E RY LNGI  H ++  D +L        
Sbjct: 118 FPETTQGQSFTLSGPRLAEMIAKTHFAMSQDETRYTLNGILLHLVSAADAELAGENGLVR 177

Query: 174 -VATDGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNI 232
            VATD HRLA+AE+ +   + +   +I+PRK V EI +++   D +V++ L E+ I ++ 
Sbjct: 178 IVATDTHRLAMAEMALDIPVEESAELIIPRKGVQEIRKLVEEDDEAVELGLDENFIRVSK 237

Query: 233 ESLSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSS 292
             + ++ +L+ G FPNYQ VIP  N   L +    L   V R+ ++S  + + ++++LSS
Sbjct: 238 PGIVLTSKLVSGRFPNYQRVIPTDNPHLLELEKEPLFGVVKRMMVLSHEKSRGIRMALSS 297

Query: 293 DKLCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDS 352
           D + ++  NP+   A E M   +    M + FN +YL EI+   +      D V  +L  
Sbjct: 298 DHIKVSAQNPEQEAAEEEMPCSFAGKDMTVGFNARYLQEIVSVANG-----DTVRMKLRD 352

Query: 353 SNSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
             S V +          + +     YVLMPMR+
Sbjct: 353 EESPVLV---------EEHSATGYLYVLMPMRV 376


>gi|268628351|gb|ACZ13574.1| DNA polymerase III beta chain [Photorhabdus asymbiotica subsp.
           australis]
          Length = 276

 Score =  194 bits (492), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 161/269 (59%), Gaps = 8/269 (2%)

Query: 65  GSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTKE 123
           G+ TV A   +DI R L DGA+IS     EL G  + +  G S F L + P ++FP+  +
Sbjct: 15  GATTVPARKFFDIWRGLPDGAEISV----ELDGDRLLVRSGRSRFSLSTLPAADFPNLDD 70

Query: 124 EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAV 183
            +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGHRLAV
Sbjct: 71  WQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGHRLAV 128

Query: 184 AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID 243
             + I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + +L+D
Sbjct: 129 CSMGI-GQNLPSHSVIVPRKGVIELMRLLDGGDTPLQLQIGSNNIRAHVGDFIFTSKLVD 187

Query: 244 GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPD 303
           G FP+Y+ V+P S DK L  +C  L+QA  R +I+S+ + + V+L  S ++L +T +NP+
Sbjct: 188 GRFPDYRRVLPKSPDKTLEASCDMLKQAFSRAAILSNEKFRGVRLYFSKNQLKITANNPE 247

Query: 304 MGKAIESMNVYYNECPMDICFNYKYLLEI 332
             +A E ++V Y    M+I FN  Y+L++
Sbjct: 248 QEEAEEIVDVSYQGTEMEIGFNVSYVLDV 276


>gi|268628267|gb|ACZ13532.1| DNA polymerase III beta chain [Xenorhabdus kozodoii]
          Length = 276

 Score =  194 bits (492), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 101/269 (37%), Positives = 163/269 (60%), Gaps = 8/269 (2%)

Query: 65  GSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTKE 123
           G+ TV A   +DI R L DGA+IS     EL G  + +  G S F L + P ++FP+  +
Sbjct: 15  GATTVPARKFFDIWRGLPDGAEISV----ELDGDRILVRSGRSRFSLSTLPATDFPNLDD 70

Query: 124 EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAV 183
            +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   +ATDGHRLAV
Sbjct: 71  WQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TIATDGHRLAV 128

Query: 184 AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID 243
             ++I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + +L+D
Sbjct: 129 CSMNI-GQNLPSHSVIVPRKGVIELMRLLDGGDNPLQLQIGSNNIRAHVGDFIFTSKLVD 187

Query: 244 GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPD 303
           G FP+Y+ V+P + DK L  NC  L+QA  R +I+S+ + + V++ LS ++L +T +NP+
Sbjct: 188 GRFPDYRRVLPKNPDKILEANCDMLKQAFSRAAILSNEKFRGVRIYLSENQLRITANNPE 247

Query: 304 MGKAIESMNVYYNECPMDICFNYKYLLEI 332
             +A E ++V Y    M+I FN  Y+L++
Sbjct: 248 QEEAEEIVDVSYQGTEMEIGFNVSYILDV 276


>gi|260774540|ref|ZP_05883453.1| DNA polymerase III beta subunit [Vibrio metschnikovii CIP 69.14]
 gi|260610446|gb|EEX35652.1| DNA polymerase III beta subunit [Vibrio metschnikovii CIP 69.14]
          Length = 308

 Score =  194 bits (492), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 104/322 (32%), Positives = 182/322 (56%), Gaps = 20/322 (6%)

Query: 64  CGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPSTKE 123
            GSITV A    DI R L D A I+   E   G  ++I  G S F L + P ++FP+ ++
Sbjct: 7   AGSITVPARKFLDICRGLPDSAVITVLLE---GDRISIRSGRSRFSLATLPANDFPNIED 63

Query: 124 EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAV 183
            +      +  + L+ L+E+T F+MA +++RYYLNG+ F I+   L+  AVATDGHR+AV
Sbjct: 64  WQSDIDITVTQAELRGLIEKTQFSMANQDVRYYLNGMMFEIDASTLR--AVATDGHRMAV 121

Query: 184 AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID 243
           A+   V+Q      II PRK + E++++L + +  V + +  S +   +     + +L+D
Sbjct: 122 AQT-TVSQALANKQIIFPRKGILELVKLLDAPEQPVVLQIGASNLRAEVNQFVFTSKLVD 180

Query: 244 GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPD 303
           G FP+Y+ V+P + +K L   C  LRQA  R +I+S+ + + V+++L+   + +T +NP+
Sbjct: 181 GRFPDYRRVLPQNTNKTLITGCDELRQAFSRAAILSNEKFRGVRVNLAEGTMRITANNPE 240

Query: 304 MGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIRGKD 363
             +A E ++V +    ++I FN  Y++++++ +       D+V   +  +N+S  I   +
Sbjct: 241 QEEAEEMLDVSFTGEAIEIGFNVSYVIDVLNTLRC-----DQVRISMSDANASALIENVE 295

Query: 364 KDSKNNKDNKVNAFYVLMPMRI 385
            DS         A YV+MP+R+
Sbjct: 296 DDS---------AMYVVMPIRL 308


>gi|268628335|gb|ACZ13566.1| DNA polymerase III beta chain [Photorhabdus temperata subsp.
           thracensis]
 gi|268628337|gb|ACZ13567.1| DNA polymerase III beta chain [Photorhabdus temperata subsp.
           thracensis]
          Length = 276

 Score =  194 bits (492), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 161/269 (59%), Gaps = 8/269 (2%)

Query: 65  GSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTKE 123
           G+ TV A   +DI R L DGA+IS     EL G  + +  G S F L + P ++FP+  +
Sbjct: 15  GATTVPARKFFDIWRGLPDGAEISV----ELDGDRLLVRSGRSRFSLSTLPAADFPNLDD 70

Query: 124 EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAV 183
            +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGHRLAV
Sbjct: 71  WQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGHRLAV 128

Query: 184 AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID 243
             + I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + +L+D
Sbjct: 129 CSMGI-GQNLPSHSVIVPRKGVIELMRLLDGGDTPLQLQIGSNNIRAHVGDFIFTSKLVD 187

Query: 244 GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPD 303
           G FP+Y+ V+P S DK L  +C  L+QA  R +I+S+ + + V+L  S ++L +T +NP+
Sbjct: 188 GRFPDYRRVLPKSPDKTLEASCDMLKQAFSRAAILSNEKFRGVRLYFSENQLKITANNPE 247

Query: 304 MGKAIESMNVYYNECPMDICFNYKYLLEI 332
             +A E ++V Y    M+I FN  Y+L++
Sbjct: 248 QEEAEEIVDVSYQGTEMEIGFNVSYVLDV 276


>gi|293391840|ref|ZP_06636174.1| DNA polymerase III, beta subunit [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290952374|gb|EFE02493.1| DNA polymerase III, beta subunit [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 366

 Score =  194 bits (492), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 116/386 (30%), Positives = 206/386 (53%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPA- 59
           M+  + R ++L+ L   C ++  +  IPV  +VLLQ  +  L I  +  E+E++   P  
Sbjct: 1   MQFIISRENLLKPLQQVCGVLNSRPNIPVLNNVLLQIENNQLNITGTDLEVELSTQTPLF 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
             +  G  T+ A    D+ R L D A+I+   E +      +    S F L + P  ++P
Sbjct: 61  HAEHDGKFTIPAKKFLDLCRSLPDNAEITVTFEEDRAI---VRSDRSKFNLSTLPAEDYP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + L+ L+E T F+MA ++ RY+LNG+ F      L+   VATDGH
Sbjct: 118 NLTDWQSEVDFTLEQATLRRLIEATQFSMANQDARYFLNGMKFETEGNLLR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + +  Q  +  S+I+PRK V E+ R+L   D   ++ +  + + + + +++ + 
Sbjct: 176 RLAVCTIPL-EQDLQTHSVILPRKGVLELARLLEPSDQPARLQIGTNNLRIQLNNITFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +LIDG FP+Y+ V+P +  + +      L+QA  R +I+S+ R ++V+L LS ++L +T 
Sbjct: 235 KLIDGRFPDYRRVLPRNATRIVEAGWETLKQAFVRAAILSNERFRSVRLQLSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
            NP+   A E ++V Y+   M++ FN  Y+L++++ +       ++V  RL  ++SS  I
Sbjct: 295 TNPEQEVAEEIIDVSYSGEEMEVGFNVSYILDVLNALKC-----NQVRIRLTDASSSCLI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              +  S         A YV+MPMR+
Sbjct: 350 EDCEDAS---------AEYVIMPMRL 366


>gi|251791867|ref|YP_003006587.1| DNA polymerase III subunit beta [Aggregatibacter aphrophilus
           NJ8700]
 gi|247533254|gb|ACS96500.1| DNA polymerase III, beta subunit [Aggregatibacter aphrophilus
           NJ8700]
          Length = 366

 Score =  193 bits (491), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 116/386 (30%), Positives = 206/386 (53%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPA- 59
           M+  + R ++L+ L   C ++  +  IPV  +VLLQ  +  L I  +  E+E++   P  
Sbjct: 1   MQFIISRENLLKPLQQVCGVLNSRPNIPVLNNVLLQIENNQLNITGTDLEVELSTKTPLL 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
             +  G  T+ A    DI R L + A+I+   E +      +    S F L + P  ++P
Sbjct: 61  HAEQDGKFTIPAKKFLDICRSLPENAEITVTFEEDRAI---VRSDRSKFNLSTLPAEDYP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + L+ L+E T F+MA ++ RY+LNG+ F      L+   VATDGH
Sbjct: 118 NLTDWQSEVDFTLEQATLRRLIEATQFSMANQDARYFLNGMKFETEGNLLR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + +  Q  +  S+I+PRK V E+ R+L   D   ++ +  + + + + +++ + 
Sbjct: 176 RLAVCTIPL-EQDLQTHSVILPRKGVLELARLLEPSDQPARLQIGTNNLRIQLNNITFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +LIDG FP+Y+ V+P +  + +      L+QA  R +I+S+ R ++V+L LS ++L +T 
Sbjct: 235 KLIDGRFPDYRRVLPRNATRIVEAGWETLKQAFVRAAILSNERFRSVRLQLSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
            NP+   A E ++V Y+   M++ FN  Y+L++++ +       ++V  RL  ++SS  I
Sbjct: 295 TNPEQEVAEEIIDVSYSGEEMEVGFNVSYILDVLNALKC-----NQVRMRLTDASSSCLI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              +  S         A YV+MPMR+
Sbjct: 350 EDCEDAS---------AEYVIMPMRL 366


>gi|315634816|ref|ZP_07890098.1| DNA-directed DNA polymerase III beta subunit [Aggregatibacter
           segnis ATCC 33393]
 gi|315476368|gb|EFU67118.1| DNA-directed DNA polymerase III beta subunit [Aggregatibacter
           segnis ATCC 33393]
          Length = 366

 Score =  193 bits (491), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 116/386 (30%), Positives = 206/386 (53%), Gaps = 21/386 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPA- 59
           M+  + R ++L+ L   C ++  +  IPV  +VLLQ  +  L I  +  E+E++   P  
Sbjct: 1   MQFIISRENLLKPLQQVCGVLNSRPNIPVLNNVLLQIENNQLSITGTDLEVELSTQTPLL 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
             +  G  T+ A    DI R L D A+I+   E +      +    S F L + P  ++P
Sbjct: 61  HAEQDGKFTIPAKKFLDICRSLPDNAEITVTFEEDRAI---VRSDRSKFNLSTLPAEDYP 117

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
           +  + +    F L  + L+ L+E T F+MA ++ RY+LNG+ F      L+   VATDGH
Sbjct: 118 NLTDWQSEVDFTLEQATLRRLIEATQFSMANQDARYFLNGMKFETEGNLLR--TVATDGH 175

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLAV  + +  Q  +  S+I+PRK V E+ R+L   +   ++ +  + + + + +++ + 
Sbjct: 176 RLAVCTIPL-EQDLQTHSVILPRKGVLELARLLEPSEQPARLQIGTNNLRIQLNNITFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           +LIDG FP+Y+ V+P +  + +      L+QA  R +I+S+ R ++V+L LS ++L +T 
Sbjct: 235 KLIDGRFPDYRRVLPRNATRIVEAGWETLKQAFVRAAILSNERFRSVRLQLSENQLKITA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
            NP+   A E ++V Y+   M++ FN  Y+L++++ +       ++V  RL  ++SS  I
Sbjct: 295 TNPEQEVAEEIIDVSYSGEEMEVGFNVSYILDVLNALKC-----NQVRMRLTDASSSCLI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMRI 385
              +  S         A YV+MPMR+
Sbjct: 350 EDCEDAS---------AEYVIMPMRL 366


>gi|268628339|gb|ACZ13568.1| DNA polymerase III beta chain [Photorhabdus temperata subsp.
           temperata]
 gi|268628341|gb|ACZ13569.1| DNA polymerase III beta chain [Photorhabdus temperata subsp.
           temperata]
 gi|268628343|gb|ACZ13570.1| DNA polymerase III beta chain [Photorhabdus temperata subsp.
           temperata]
          Length = 276

 Score =  193 bits (490), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 161/269 (59%), Gaps = 8/269 (2%)

Query: 65  GSITVSAHLLYDIVRKLQDGAQISFFKENEL-GTEVNISHGDSNFYLQSFPESEFPSTKE 123
           G+ TV A   +DI R L DGA+IS     EL G  + +  G S F L + P ++FP+  +
Sbjct: 15  GATTVPARKFFDIWRGLPDGAEISV----ELDGDRLLVRSGRSRFSLSTLPAADFPNLDD 70

Query: 124 EEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAV 183
            +    F L  + LK L+E T F+MA +++RYYLNG+ F    E+L+   VATDGHRLAV
Sbjct: 71  WQSDVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETEGEELR--TVATDGHRLAV 128

Query: 184 AEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID 243
             + I  Q     S+IVPRK V E++R+L   D+ +++ +  + I  ++     + +L+D
Sbjct: 129 CSMGI-GQNLPSHSVIVPRKGVIELMRLLDGGDTPLQLQIGSNNIRAHVGDFIFTSKLVD 187

Query: 244 GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPD 303