PSIBLAST alignment of GI: 254780454 and protein with PDB id: 2avt

>gi|88192167|pdb|2AVT|A Chain A, Crystal Structure Of The Beta Subunit From Dna Polymerase Of Streptococcus Pyogenes Length = 378
>gi|88192168|pdb|2AVT|B Chain B, Crystal Structure Of The Beta Subunit From Dna Polymerase Of Streptococcus Pyogenes Length = 378
 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 84/392 (21%), Positives = 171/392 (43%), Gaps = 27/392 (6%)

Query: 2   KITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS- 60
           + ++ R+  +  L    R I  KN IP+   + ++     + +  S  +I I   IP S 
Sbjct: 3   QFSINRTLFIHALNTTKRAISTKNAIPILSSIKIEVTSTGVTLTGSNGQISIENTIPVSN 62

Query: 61  ------VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFP 114
                 +   G+I + A    +I+  L D +      E     +V ++ G S   L+   
Sbjct: 63  ENAGLLITSPGAILLEASFFINIISSLPDISINVKEIEQ---HQVVLTSGKSEITLKGKD 119

Query: 115 ESEFPSTKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAV 174
             ++P  +E        L + +LK+++  T FA + +E R  L G+   ++       AV
Sbjct: 120 VDQYPRLQEVSTENPLILKTKLLKSIIAETAFAASLQESRPILTGVHIVLS-NHKDFKAV 178

Query: 175 ATDGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIES 234
           ATD HR++   + +    A    +++P K++ E   + +    +V+V  S S+I    E 
Sbjct: 179 ATDSHRMSQRLITLDNTSAD-FMVVLPSKSLREFSAVFTDDIETVEVFFSPSQILFRSEH 237

Query: 235 LSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKL-SLSSD 293
           +S   RL++G +P+   ++    + E+  N  +LR A++R  ++S+          ++ +
Sbjct: 238 ISFYTRLLEGNYPDTDRLLMTEFETEVVFNTQSLRHAMERAFLISNATQNGTVKLEITQN 297

Query: 294 KLCMTVDNPDMGKAIESMNV-YYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDS 352
            +   V++P++GK  E +++   +   + I FN  YL+E +  I S     + V     S
Sbjct: 298 HISAHVNSPEVGKVNEDLDIVSQSGSDLTISFNPTYLIESLKAIKS-----ETVKIHFLS 352

Query: 353 SNSSVFIRGKDKDSKNNKDNKVNAFYVLMPMR 384
                 +   D++         +   ++ P+R
Sbjct: 353 PVRPFTLTPGDEE--------ESFIQLITPVR 376