RPSBLAST alignment for GI: 254780454 and conserved domain: smart00480

>gnl|CDD|128756 smart00480, POL3Bc, DNA polymerase III beta subunit. Length = 345
 Score =  253 bits (649), Expect = 5e-68
 Identities = 125/352 (35%), Positives = 211/352 (59%), Gaps = 15/352 (4%)

Query: 17  ACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPASVDVC-GSITVSAHLLY 75
             R+I  +NTIP+  ++LL+A D  L + A+  EI I  +I A V+   GS+TV A    
Sbjct: 1   VSRVISNRNTIPILSNILLEAKDDGLTLTATDLEISIKSSISAEVEDEEGSVTVPAKKFL 60

Query: 76  DIVRKLQDGAQISF-FKENELGTEVNISHGDSNFYLQSFPESEFPSTKEEEYVYSFELAS 134
           DIVRKL D  +I+   +E++L     I+ G S F L +    EFP     E   +FEL +
Sbjct: 61  DIVRKLPD-KEITLSVEEDKL----VITSGKSRFNLPTLDAEEFPELPFIEEGVTFELPT 115

Query: 135 SVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAVAEVDIVAQIAK 194
            +LK  +E+T FA++T+E R  LNG+   I+  +L+L  VATDGHRLAV E+ + ++   
Sbjct: 116 KLLKEGIEKTAFAVSTDETRPVLNGVNLEISNGELRL--VATDGHRLAVREIKLESEEDD 173

Query: 195 MPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLIDGEFPNYQNVIP 254
             S+I+PRK++ E+ ++L+  +  V++ +S ++I     ++  + RLIDGEFP+Y+ VIP
Sbjct: 174 F-SVIIPRKSLLELNKLLTDNEELVEIFISSNQILFETGNVIFTSRLIDGEFPDYKRVIP 232

Query: 255 CSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPDMGKAIESMNVY 314
              + +L VN   L++A+ RV+++++ + ++VKL+L   +L +T ++P++G+A E ++V 
Sbjct: 233 KEFETKLTVNRKELKEALKRVALLANEKNRSVKLTLEEGQLKLTANSPEVGEAEEEVDVD 292

Query: 315 YNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIRGKDKDS 366
           Y    ++I FN KYLL+ +  + S     +E+  +   S+S   I   D + 
Sbjct: 293 YEGEDLEIAFNPKYLLDALKALKS-----EEIELKFTDSSSPFLISPPDDEK 339