RPSBLAST alignment for GI: 254780454 and conserved domain: PRK14943

>gnl|CDD|184907 PRK14943, PRK14943, DNA polymerase III subunit beta; Provisional. Length = 374
 Score =  191 bits (486), Expect = 3e-49
 Identities = 106/395 (26%), Positives = 187/395 (47%), Gaps = 32/395 (8%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK  + +   L  L     ++  K T+P+  +VL++A +G + +  +  ++ I   I A+
Sbjct: 1   MKFKINKDHFLNGLRQVLNVVSSKTTMPILSNVLIEAENGQISLTTTNLDLGIRCVIKAN 60

Query: 61  VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120
           V   G++T+    L  IVR+L    +     +     +  +  G S F +   P  EFP 
Sbjct: 61  VLREGTVTLPVKKLATIVREL---PEAEVQVDANQNNQAKVESGGSQFKIMGIPAEEFPP 117

Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180
               E    F+L  S L+++++   +A +T+E RY LNG++F  N  D KL  VATDG R
Sbjct: 118 LPSFEQATVFQLEQSELRDMLKSVEYAQSTDETRYILNGVYF--NFRDGKLTLVATDGRR 175

Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNI-------- 232
           LA+AE ++     +    I+P K VGE+ R+L  K   +K+  ++ +    I        
Sbjct: 176 LALAETELEFPEDQAGDAILPAKTVGELRRLLD-KGGKLKIRFNDRQAAFEISIGEDSSG 234

Query: 233 --ESLSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSL 290
                 +  +L++G +PNY+ VIP    + +++    L + V R +++SS +  +VKL  
Sbjct: 235 LANDTYLISKLVEGNYPNYRQVIPKETKERIKLERELLLECVHRAALVSSDKSNSVKLKF 294

Query: 291 SSDKLCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRL 350
           S + L +   +  +G+A ESM + Y+   + + FN  + +  +  ++ DE          
Sbjct: 295 SENLLEIASSSEGVGEAHESMAITYSGPELQVAFNPDFFMAPLKALTKDE---------- 344

Query: 351 DSSNSSVFIRGKDKDSKNNKDNKVNAFYVLMPMRI 385
                 VF   KD+ S            V+MPMR+
Sbjct: 345 ------VFFELKDEMSPGVFKTLDEFLCVIMPMRL 373