RPSBLAST alignment for GI: 254780454 and conserved domain: cd00140

>gnl|CDD|29053 cd00140, beta_clamp, Beta clamp domain. The beta subunit (processivity factor) of DNA polymerase III holoenzyme, refered to as the beta clamp, forms a ring shaped dimer that encircles dsDNA (sliding clamp) in bacteria. The beta-clamp is structurally similar to the trimeric ring formed by PCNA (found in eukaryotes and archaea) and the processivity factor (found in bacteriophages T4 and RB69). This structural correspondence further substantiates the mechanistic connection between eukaryotic and prokaryotic DNA replication that has been suggested on biochemical grounds. . Length = 365
 Score =  311 bits (798), Expect = 2e-85
 Identities = 151/385 (39%), Positives = 229/385 (59%), Gaps = 21/385 (5%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPA- 59
           MK T+ R  +LE L    R IE +NTIP+  +VL++A+DG L + A+  EI I   IPA 
Sbjct: 1   MKFTINREALLEALQKVSRAIESRNTIPILSNVLIEASDGGLTLTATDLEISIKTTIPAE 60

Query: 60  SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
            V+  GS+TV A  L DIVRKL D  +++   E      + I  G S F L + P  EFP
Sbjct: 61  EVEEEGSVTVPAKKLLDIVRKLPDE-EVTLETEEN---RLTIKSGKSRFSLNTLPAEEFP 116

Query: 120 STKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGH 179
              E E   SF + +S LK L+++T FA++T+E R  LNG+   I +   KL AVATDGH
Sbjct: 117 ELPEIENGSSFTIPASELKELIKKTAFAVSTDETRPILNGVLLEIEDN--KLRAVATDGH 174

Query: 180 RLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSV 239
           RLA+ E+++ +   +  ++IVPRK + E+L++L   D  V++S+SE++I   + + + + 
Sbjct: 175 RLALREIELESGAEEDFNVIVPRKTLNELLKLLEDDDEEVEISISENQILFKLGNTTFTS 234

Query: 240 RLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTV 299
           RLI+GEFP+Y+ VIP   +K L V+   L +A+ RVS++S+ + + VKL +S  +L ++ 
Sbjct: 235 RLIEGEFPDYERVIPKEFEKSLTVDREELLEALKRVSLLSNEKNRGVKLEISEGQLKLSA 294

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFI 359
           +NP++G+A E + V Y    ++I FN KYLL+ +  I S     +EV      SNS V I
Sbjct: 295 NNPEIGEAEEELEVEYEGEELEIGFNPKYLLDALKAIDS-----EEVRLSFTDSNSPVLI 349

Query: 360 RGKDKDSKNNKDNKVNAFYVLMPMR 384
             +D D         N  Y++MP+R
Sbjct: 350 TPEDDD---------NFLYLIMPVR 365