RPSBLAST alignment of GI: 254780454 and MMDB domain: 1rwz_A_

>1rwz_A (A:) DNA polymerase sliding clamp; torus, processivity factor, replication; HET: DNA; 1.80A {Archaeoglobus fulgidus}Length = 245
 Score =  143 bits (362), Expect = 3e-35
 Identities = 41/258 (15%), Positives = 84/258 (32%), Gaps = 27/258 (10%)

Query: 137 LKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAVAEVDIVA------ 190
           +  ++        T  I   ++    H  E+   L + A D   +A+  VDI        
Sbjct: 2   IDVIMTGELLKTVTRAIVALVSEARIHFLEK--GLHSRAVDPANVAMVIVDIPKDSFEVY 59

Query: 191 QIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVRLIDGEFPNYQ 250
            I +  +I V    + +I + +S+KD    +   ES + +   S+   V LID      +
Sbjct: 60  NIDEEKTIGVDMDRIFDISKSISTKDLVELIVEDESTLKVKFGSVEYKVALIDPSAIRKE 119

Query: 251 NVIP-CSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPDMGKAI- 308
             IP      ++ ++    ++A+     +       V      +   +            
Sbjct: 120 PRIPELELPAKIVMDAGEFKKAIAAADKI----SDQVIFRSDKEGFRIEAKGDVDSIVFH 175

Query: 309 --ESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIRGKDKDS 366
             E+  + +N       F+  YL E      S      +++     +N  V +  +    
Sbjct: 176 MTETELIEFNGGEARSMFSVDYLKEFCKVAGS-----GDLLTIHLGTNYPVRLVFELVGG 230

Query: 367 KNNKDNKVNAFYVLMPMR 384
           +          Y+L P  
Sbjct: 231 RA------KVEYILAPRI 242