RPSBLAST alignment of GI: 254780454 and MMDB domain: 1u7b_A_

>1u7b_A (A:) PCNA, cyclin, proliferating cell nuclear antigen; sliding clamp, DNA processing, FEN1, PIP- BOX, replication; 1.88A {Homo sapiens}Length = 261
 Score =  125 bits (315), Expect = 8e-30
 Identities = 24/263 (9%), Positives = 75/263 (28%), Gaps = 33/263 (12%)

Query: 140 LVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAVAEVDIVA------QIA 193
           LV+ +      E ++  +N   + I+   + L   + D   +++ ++ + +      +  
Sbjct: 6   LVQGSILKKVLEALKDLINEACWDISSSGVNL--QSMDSSHVSLVQLTLRSEGFDTYRCD 63

Query: 194 KMPSIIVPRKAVGEILRIL-SSKDSSVKVSLSESRIHLNIESLSMSV-----RLIDGEFP 247
           +  ++ V   ++ +IL+   +    +++   +   + L  E+ +          +     
Sbjct: 64  RNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDV 123

Query: 248 NYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAV-------KLSLSSDKLCMTVD 300
               +        +++      +    +S +    + +          S       + + 
Sbjct: 124 EQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLS 183

Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360
                   E         P+ + F  +YL            +   V   + +    V   
Sbjct: 184 QTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATP----LSSTVTLSMSADVPLVVEY 239

Query: 361 GKDKDSKNNKDNKVNAFYVLMPM 383
                         +  Y L P 
Sbjct: 240 KIADMG--------HLKYYLAPK 254