RPSBLAST alignment of GI: 254780454 and MMDB domain: 2ijx_A_

>2ijx_A (A:) DNA polymerase sliding clamp A; PCNA3 subunit, protein-protein interaction, PCNA123 heterotrimer, DNA binding protein; HET: DNA; 1.90A {Sulfolobus solfataricus P2} PDB: 2nti_F* 2hii_C 2hik_C 2ix2_C*Length = 244
 Score =  129 bits (324), Expect = 8e-31
 Identities = 25/253 (9%), Positives = 78/253 (30%), Gaps = 23/253 (9%)

Query: 140 LVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAVAEVDIVA------QIA 193
             +        + +   ++       ++ ++L  VA D   +++  V++         + 
Sbjct: 5   YDDVRVLKDIIQALARLVDEAVLKFKQDSVEL--VALDRAHISLISVNLPREMFKEYDVN 62

Query: 194 KMPSIIVPRKAVGEILRILSSKDS-SVKVSLSESRIHLNIESLSMSVRLIDGEFPNYQNV 252
                    + + +IL++   K++  +     +S I   I S +    + + E    +  
Sbjct: 63  DEFKFGFNTQYLMKILKVAKRKEAIEIASESPDSVIINIIGSTNREFNVRNLEVSEQEIP 122

Query: 253 IP-CSNDKELRVNCTNLRQAVDRVSIMSS-VRIQAVKLSLSSDKLCMTVDNPDMGKAIES 310
                 D    ++    + A+  VS ++  V ++  +  +       +    +  K    
Sbjct: 123 EINLQFDISATISSDGFKSAISEVSTVTDNVVVEGHEDRILIKAEGESEVEVEFSKDTGG 182

Query: 311 MNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIRGKDKDSKNNK 370
           +            ++ +YL +++           + V     +   + +    +      
Sbjct: 183 LQDLEFSKESKNSYSAEYLDDVLSLTKL-----SDYVKISFGNQKPLQLFFNMEGG---- 233

Query: 371 DNKVNAFYVLMPM 383
                  Y+L P 
Sbjct: 234 ---GKVTYLLAPK 243