RPSBLAST alignment of GI: 254780454 and MMDB domain: 3d1g_A_1-131_198-244

>3d1g_A (A:1-131,A:198-244) DNA polymerase III subunit beta; chemical probe, DNA sliding clamp, DNA replication, rational drug design, antibiotic target, transferase; HET: DNA 322; 1.64A {Escherichia coli}Length = 178
 Score =  107 bits (269), Expect = 3e-24
 Identities = 41/138 (29%), Positives = 68/138 (49%), Gaps = 4/138 (2%)

Query: 1   MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60
           MK TVER  +L+ L      +  + T+P+  ++LLQ  DG L +  +  E+E+   +   
Sbjct: 1   MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALV 60

Query: 61  VDVC-GSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFP 119
                G+ TV A   +DI R L +GA+I+   E E    + +  G S F L + P ++FP
Sbjct: 61  QPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGE---RMLVRSGRSRFSLSTLPAADFP 117

Query: 120 STKEEEYVYSFELASSVL 137
           +  + +    F L   V+
Sbjct: 118 NLDDWQSEVEFTLPKGVI 135