RPSBLAST alignment of GI: 254780454 and protein with PDBid: 3k4x

>3k4x_A PCNA, proliferating cell nuclear antigen; DNA replication, DNA-binding; HET: DNA; 2.98A {Saccharomyces cerevisiae} Length = 798
 Score = 75.5 bits (186), Expect = 2e-14
 Identities = 39/223 (17%), Positives = 85/223 (38%), Gaps = 23/223 (10%)

Query: 140 LVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAVAEVDIVA------QIA 193
             E + F    +  +  +  + F   E+ +     A D  R+ +  ++I        +  
Sbjct: 12  FEEASLFKRIIDGFKDCVQLVNFQCKEDGIIA--QAVDDSRVLLVSLEIGVEAFQEYRCD 69

Query: 194 KMPSIIVPRKAVGEILRILSSKDS-SVKVSLSESRIHLNIES------LSMSVRLIDGEF 246
              ++ +   ++ +ILR  ++ D+ ++    +   I L  E          S++L+D + 
Sbjct: 70  HPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDA 129

Query: 247 PNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMS-SVRIQA----VKLSLSSD--KLCMTV 299
              + +     D  L +  +   + V  +S +S S+ I      +K     D     + +
Sbjct: 130 DFLK-IEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVII 188

Query: 300 DNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVV 342
                 +  E+      + P+D+ F  KYLL+II   S  + V
Sbjct: 189 KPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRV 231