>cd04465 S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain.While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 2 of the Escherichia coli and Homo sapiens RPS1 (ec2 and hs2, respectively). Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.

Probab=99.30 E-value=2.1e-11 Score=86.45 Aligned_cols=67 Identities=18% Similarity=0.388 Sum_probs=62.5 Q ss_pred CCEEEEEEEEEECCEEEEEECCCCCEEEEEEHHHCCHHHHCCCHHHCCCCCEEEEEEEEECCCCCEEEEEEH Q ss_conf 987999999970890899961779849999974718212104201106898799999997057686998703 Q gi|254780456|r 459 NDVVSCEVISVSEGGIEVSLIDHKGINSFIRRSDLSRDRVDQDPGRFSKGQIVDACVVNVSKKDGKVSLSIK 530 (576) Q Consensus 459 G~iv~g~V~~v~~~G~~V~l~~~~gv~G~i~~s~is~~~~~~~~~~~~vG~~v~~~Vi~id~~~~ri~LS~k 530 (576) T Consensus 1 g~~v~g~I~~~~kGG~~v~~---~gv~~FiP~Sq~~~~~~~~~~~~--vG~~i~~~Ii~~d~~~~~ivvSrk 67 (67) T cd04465 1 GEIVEGKVTEKVKGGLIVDI---EGVRAFLPASQVDLRPVEDLDEY--VGKELKFKIIEIDRERNNIVLSRR 67 (67) T ss_pred CCEEEEEEEEEECCCEEEEE---CCEEEEEECHHCCCCCCCCHHHH--CCCEEEEEEEEEECCCCEEEEECC T ss_conf 99999999999857199999---99999988025255456896897--899899999999278899999879

HHsearch alignment for GI: 254780456 and conserved domain: cd04465