>cd05690 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 5 (ec5) of the Escherichia coli RPS1. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.

Probab=99.71 E-value=2.1e-17 Score=122.75 Aligned_cols=68 Identities=53% Similarity=0.948 Sum_probs=57.3 Q ss_pred CCEEEEEEEEECCCEEEEEECCCCEEEEECCCCCCCCCCCCCCCEECCCCEEEEEEEEEECCCCEEEE Q ss_conf 96658999981596699985142000000111101113557421003784579999986215504787 Q gi|254780456|r 283 GSKVSGVVTNLTDYGVFVELQSGIEGLAHISQISWTKKNIHPSKILSVGQQVEVVILEVNPARKRISL 350 (576) Q Consensus 283 G~~v~g~V~~v~~~G~~V~l~~~v~G~i~~sels~~~~~~~~~~~~~~G~~v~~~Vl~id~~~~~i~l 350 (576) T Consensus 1 G~~v~G~V~~i~~fG~FV~l~~gieGLvHiselsw~~~~~~~~~~~~~Gd~V~vkVl~iD~e~~risL 68 (69) T cd05690 1 GTVVSGKIKSITDFGIFVGLDGGIDGLVHISDISWTQRVRHPSEIYKKGQEVEAVVLNIDVERERISL 68 (69) T ss_pred CCEEEEEEEEECCCEEEEEECCCCEEEEEHHHHCCCCCCCCHHHCCCCCCEEEEEEEEEECCCCEECC T ss_conf 99999999999131899997699659999488245666679768258999999999999798688638

HHsearch alignment for GI: 254780456 and conserved domain: cd05690