>cd05691 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 6 (ec6) of the Escherichia coli RPS1. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.

Probab=99.73 E-value=2.1e-17 Score=122.76 Aligned_cols=73 Identities=42% Similarity=0.651 Sum_probs=53.1 Q ss_pred CCEEEEEEEEEECCEEEEEECCCCCEEEEEEHHHCCHHHHCCCHHHCCCCCEEEEEEEEECCCCCEEEEEEHHHH Q ss_conf 987999999970890899961779849999974718212104201106898799999997057686998703655 Q gi|254780456|r 459 NDVVSCEVISVSEGGIEVSLIDHKGINSFIRRSDLSRDRVDQDPGRFSKGQIVDACVVNVSKKDGKVSLSIKALE 533 (576) Q Consensus 459 G~iv~g~V~~v~~~G~~V~l~~~~gv~G~i~~s~is~~~~~~~~~~~~vG~~v~~~Vi~id~~~~ri~LS~k~~~ 533 (576) T Consensus 1 G~iV~G~V~~i~~~G~fV~l~--~~v~G~ih~sels~~~~~~~~~~~~vGd~v~akIi~iD~~~~ri~LSiKalE 73 (73) T cd05691 1 GSIVTGKVTEVDAKGATVKLG--DGVEGFLRAAELSRDRVEDATERFKVGDEVEAKITNVDRKNRKISLSIKAKE 73 (73) T ss_pred CCEEEEEEEEEECCCEEEEEC--CCCEEEEEHHHCCCCHHHCHHHCCCCCCEEEEEEEEEECCCCEEEEEEEECC T ss_conf 999999999997786899928--9969999989978211329254389999999999999788999986742459

HHsearch alignment for GI: 254780456 and conserved domain: cd05691