>cd05695 S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 3 (hs3). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.

Probab=98.65 E-value=8.7e-08 Score=64.49 Aligned_cols=66 Identities=20% Similarity=0.306 Sum_probs=30.9 Q ss_pred CCEEEEEEEEEECCEEEEEECCCCCEEEEEEHHHCCHHHHCCCHHHCCCCCEEEEEEEEECCCCCEEEEE Q ss_conf 9879999999708908999617798499999747182121042011068987999999970576869987 Q gi|254780456|r 459 NDVVSCEVISVSEGGIEVSLIDHKGINSFIRRSDLSRDRVDQDPGRFSKGQIVDACVVNVSKKDGKVSLS 528 (576) Q Consensus 459 G~iv~g~V~~v~~~G~~V~l~~~~gv~G~i~~s~is~~~~~~~~~~~~vG~~v~~~Vi~id~~~~ri~LS 528 (576) T Consensus 1 GmlV~a~V~kV~~~Gl~~~fl~--~F~G~Vd~~HL~~~~--~~~~~Y~~~~~v~ArIL~Vdp~tK~V~Ls 66 (66) T cd05695 1 GMLVNARVKKVLSNGLILDFLS--SFTGTVDFLHLDPEK--SSKSTYKEGQKVRARILYVDPSTKVVGLS 66 (66) T ss_pred CCEEEEEEEEECCCCEEEEEEC--CEEEEEEHHHCCCCC--CCCCCCCCCCEEEEEEEEECCCCCEEECC T ss_conf 9559999999817948999651--289998876768776--87000467988999999998874788539

HHsearch alignment for GI: 254780456 and conserved domain: cd05695