RPSBLAST alignment for GI: 254780456 and conserved domain: cd05692

>gnl|CDD|88447 cd05692, S1_RPS1_repeat_hs4, S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 4 (hs4) of the H. sapiens RPS1 homolog. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.. Length = 69
 Score = 41.8 bits (98), Expect = 5e-04
 Identities = 28/72 (38%), Positives = 39/72 (54%), Gaps = 4/72 (5%)

Query: 370 GTEVEGEVKNKTDFGLFIGLDEHLDGMIHLSDLDWNRPGEKVIAEYAK-GDIVKAVVLDI 428
           G+ VEG V     FG F+ L   + G++H+S +   R   K + +  K GD VK  VL I
Sbjct: 1   GSVVEGTVTRLKPFGAFVELGGGISGLVHISQIAHKRV--KDVKDVLKEGDKVKVKVLSI 58

Query: 429 DVGKERISLGVK 440
           D  + RISL +K
Sbjct: 59  D-ARGRISLSIK 69