>gnl|CDD|88462 cd05707, S1_Rrp5_repeat_sc11, S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes S. cerevisiae S1 repeat 11 (sc11). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.. Length = 68

 Score = 41.7 bits (98), Expect = 6e-04
 Identities = 26/67 (38%), Positives = 39/67 (58%), Gaps = 1/67 (1%)

Query: 198 GQVIEGTVKNITDYGVFVDLS-GVDGLLHVTDIAWHRILHPSKVLSIGQQVKVKIIRINQ 256
           G V+ G VKNI + GVFV L  GVD  + V++++   +    K   +GQ VK KI+ I+ 
Sbjct: 1   GDVVRGFVKNIANNGVFVTLGRGVDARVRVSELSDSYLKDWKKRFKVGQLVKGKIVSIDP 60

Query: 257 ETHRISL 263
           +  RI +
Sbjct: 61  DNGRIEM 67