HHsearch alignment for GI: 254780457 and conserved domain: COG0324

>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis].
Probab=97.11  E-value=0.0048  Score=39.10  Aligned_cols=41  Identities=29%  Similarity=0.460  Sum_probs=34.0

Q ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHCCCEE--ECCHHHHHHH
Q ss_conf             8818986668778967899999998178356--2028999998
Q gi|254780457|r    7 QSIIIAIDGTAAAGKGVLSRFIALEYGFHYL--DTGLIYRAVA   47 (217)
Q Consensus         7 k~~iIaIDGpagsGKsT~ak~lA~~l~~~~l--dtG~~YR~~a   47 (217)
T Consensus         2 ~~~~i~I~GPTAsGKT~lai~LAk~~~~eIIs~DSmQvYr~md   44 (308)
T COG0324           2 KPKLIVIAGPTASGKTALAIALAKRLGGEIISLDSMQVYRGLD   44 (308)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHCCCCEEECCHHHHCCCCC
T ss_conf             9637999898875778999999998299289302355318886