HHsearch alignment for GI: 254780457 and conserved domain: COG0396

>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones].
Probab=93.99  E-value=0.046  Score=33.23  Aligned_cols=32  Identities=22%  Similarity=0.251  Sum_probs=26.8

Q ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHCCCEEE
Q ss_conf             88189866687789678999999981783562
Q gi|254780457|r    7 QSIIIAIDGTAAAGKGVLSRFIALEYGFHYLD   38 (217)
Q Consensus         7 k~~iIaIDGpagsGKsT~ak~lA~~l~~~~ld   38 (217)
T Consensus        29 ~GEvhaiMGPNGsGKSTLa~~i~G~p~Y~Vt~   60 (251)
T COG0396          29 EGEVHAIMGPNGSGKSTLAYTIMGHPKYEVTE   60 (251)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCCEEEC
T ss_conf             98289998899878899999972899746755