HHsearch alignment for GI: 254780457 and conserved domain: COG1102

>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism].
Probab=100.00  E-value=1.2e-31  Score=210.03  Aligned_cols=166  Identities=25%  Similarity=0.408  Sum_probs=147.3

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHHCCCEEECCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHCC
Q ss_conf             18986668778967899999998178356202899999852321011101465533332101112444444320121001
Q gi|254780457|r    9 IIIAIDGTAAAGKGVLSRFIALEYGFHYLDTGLIYRAVAKNILDAGISLDDEKMAIKIAQNIVLSNLDKAQLSSNAIANV   88 (217)
Q Consensus         9 ~iIaIDGpagsGKsT~ak~lA~~l~~~~ldtG~~YR~~a~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~lr~~~I~~~   88 (217)
T Consensus         1 m~ItIsG~pGsG~TTva~~lAe~~gl~~vsaG~iFR~~A~---e~gmsl~ef~~~AE-----------------------   54 (179)
T COG1102           1 MVITISGLPGSGKTTVARELAEHLGLKLVSAGTIFREMAR---ERGMSLEEFSRYAE-----------------------   54 (179)
T ss_pred             CEEEECCCCCCCCHHHHHHHHHHHCCCEEECCHHHHHHHH---HCCCCHHHHHHHHH-----------------------
T ss_conf             9799617999970279999999829715621279999999---83999999999875-----------------------


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHCCCEEEECCCHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             11122057899998878888763038846206412556630388689984488889999866776521113569999999
Q gi|254780457|r   89 ASQVASIDSVRDALIDIQRSFAQNKLGVILDGRDIGTIIFPDARIKFYVTASLDIRARRRYNEMVSRGEKVDYVKILEDL  168 (217)
Q Consensus        89 ~S~iA~~p~VR~~l~~~Qr~~~~~~~g~V~EGRDigTvVfPdA~~KifL~As~e~RA~RR~~el~~~g~~~~~~ev~~~i  168 (217)
T Consensus        55 -----~~p~iD~~iD~rq~e~a~-~~nvVlegrLA~Wi~k~~adlkI~L~Apl~vRa~R-----ia~REgi~~~~a~~~~  123 (179)
T COG1102          55 -----EDPEIDKEIDRRQKELAK-EGNVVLEGRLAGWIVREYADLKIWLKAPLEVRAER-----IAKREGIDVDEALAET  123 (179)
T ss_pred             -----CCCHHHHHHHHHHHHHHH-CCCEEEHHHHHHHHHCCCCCEEEEEECCHHHHHHH-----HHHHCCCCHHHHHHHH
T ss_conf             -----192166998899999987-28958700457887335654688885759999999-----9986089899999999


Q ss_pred             HHHHHHCCCC-------CCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             9985610236-------75785379973999778989899999999999987
Q gi|254780457|r  169 RNRDNQDRNR-------SYCPLVRDKDAYFFDTSEMDIGTMCKVAKGLIDTK  213 (217)
Q Consensus       169 ~~RD~~D~~R-------~~sPL~~a~DAi~IDTs~lsi~ev~~~i~~~I~~k  213 (217)
T Consensus       124 ~~RE~se~kRY~~~YgIDidDlSiyD--LVinTs~~~~~~v~~il~~aid~~  173 (179)
T COG1102         124 VEREESEKKRYKKIYGIDIDDLSIYD--LVINTSKWDPEEVFLILLDAIDAL  173 (179)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCEEEE--EEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             99889999999998587876663677--887536678889999999998742