HHsearch alignment for GI: 254780457 and conserved domain: COG1125

>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism].
Probab=94.10  E-value=0.052  Score=32.94  Aligned_cols=48  Identities=21%  Similarity=0.261  Sum_probs=30.5

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHH----CCCE--------EECCHHHHHHHHHHHHCCC
Q ss_conf             8189866687789678999999981----7835--------6202899999852321011
Q gi|254780457|r    8 SIIIAIDGTAAAGKGVLSRFIALEY----GFHY--------LDTGLIYRAVAKNILDAGI   55 (217)
Q Consensus         8 ~~iIaIDGpagsGKsT~ak~lA~~l----~~~~--------ldtG~~YR~~a~~~~~~~~   55 (217)
T Consensus        27 gef~vliGpSGsGKTTtLkMINrLiept~G~I~i~g~~i~~~d~~~LRr~IGYviQqigL   86 (309)
T COG1125          27 GEFLVLIGPSGSGKTTTLKMINRLIEPTSGEILIDGEDISDLDPVELRRKIGYVIQQIGL   86 (309)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHHHHHHHHCCC
T ss_conf             728999878997578799999605588885389899044658889998753354222156