HHsearch alignment for GI: 254780457 and conserved domain: COG4618

>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only].
Probab=96.21  E-value=0.0036  Score=39.87  Aligned_cols=35  Identities=26%  Similarity=0.388  Sum_probs=26.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHH----CCCEEECCHHHH
Q ss_conf             89866687789678999999981----783562028999
Q gi|254780457|r   10 IIAIDGTAAAGKGVLSRFIALEY----GFHYLDTGLIYR   44 (217)
Q Consensus        10 iIaIDGpagsGKsT~ak~lA~~l----~~~~ldtG~~YR   44 (217)
T Consensus       364 ~lgIIGPSgSGKSTLaR~lvG~w~p~~G~VRLDga~l~q  402 (580)
T COG4618         364 ALGIIGPSGSGKSTLARLLVGIWPPTSGSVRLDGADLRQ  402 (580)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCCCCCCEEECCHHHHC
T ss_conf             678878887657789999981135678737756264512