HHsearch alignment for GI: 254780457 and conserved domain: KOG0635

>KOG0635 consensus.
Probab=97.36  E-value=0.0037  Score=39.74  Aligned_cols=158  Identities=18%  Similarity=0.286  Sum_probs=84.3

Q ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHHHC----CCEEECCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCC-C
Q ss_conf             555881898666877896789999999817----83562028999998523210111014655333321011124444-4
Q gi|254780457|r    4 LESQSIIIAIDGTAAAGKGVLSRFIALEYG----FHYLDTGLIYRAVAKNILDAGISLDDEKMAIKIAQNIVLSNLDK-A   78 (217)
Q Consensus         4 ~~~k~~iIaIDGpagsGKsT~ak~lA~~l~----~~~ldtG~~YR~~a~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~-~   78 (217)
T Consensus        27 ~~qkGcviWiTGLSgSGKStlACaL~q~L~qrgkl~Y~LDGD-----------------N--vRhGLN~DL~F~a~dR~E   87 (207)
T KOG0635          27 LKQKGCVIWITGLSGSGKSTLACALSQALLQRGKLTYILDGD-----------------N--VRHGLNKDLGFKAEDRNE   87 (207)
T ss_pred             HCCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCEEEEECCC-----------------C--CCCCCCCCCCCCHHHHHH
T ss_conf             568996899742577880259999999998658658985485-----------------4--010434456765033446


Q ss_pred             CCCCHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCEEE---------ECCCHHHHHHCCCCEE-EEEECCHHHHHHHH
Q ss_conf             4320121001111220578999988788887630388462---------0641255663038868-99844888899998
Q gi|254780457|r   79 QLSSNAIANVASQVASIDSVRDALIDIQRSFAQNKLGVIL---------DGRDIGTIIFPDARIK-FYVTASLDIRARRR  148 (217)
Q Consensus        79 ~lr~~~I~~~~S~iA~~p~VR~~l~~~Qr~~~~~~~g~V~---------EGRDigTvVfPdA~~K-ifL~As~e~RA~RR  148 (217)
T Consensus        88 NIRR------igeVaK-------------LFADa--g~iciaSlISPYR~dRdacRel~~~~~FiEvfmdvpl~vcE~RD  146 (207)
T KOG0635          88 NIRR------IGEVAK-------------LFADA--GVICIASLISPYRKDRDACRELLPEGDFIEVFMDVPLEVCEARD  146 (207)
T ss_pred             HHHH------HHHHHH-------------HHHCC--CEEEEEHHCCCHHCCHHHHHHHCCCCCEEEEEECCCHHHHHCCC
T ss_conf             5788------899999-------------87325--40310021580020579999736689858887528687864148


Q ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCE-EEEECCCCC-HHHHHHHHHHHHHHH
Q ss_conf             66776521113569999999998561023675785379973-999778989-899999999999987
Q gi|254780457|r  149 YNEMVSRGEKVDYVKILEDLRNRDNQDRNRSYCPLVRDKDA-YFFDTSEMD-IGTMCKVAKGLIDTK  213 (217)
Q Consensus       149 ~~el~~~g~~~~~~ev~~~i~~RD~~D~~R~~sPL~~a~DA-i~IDTs~ls-i~ev~~~i~~~I~~k  213 (217)
T Consensus       147 PKGLYK~A------------RaGkIKgFTGIddPYEaP~~cEi~l~~~~~~sp~~mae~iv~YL~~k  201 (207)
T KOG0635         147 PKGLYKLA------------RAGKIKGFTGIDDPYEAPLNCEIVLKSHESSSPEEMAEIIVSYLDNK  201 (207)
T ss_pred             CHHHHHHH------------HCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHC
T ss_conf             40478887------------45652354467886668878678974578888799999999998614