HHsearch alignment for GI: 254780457 and conserved domain: KOG0736

>KOG0736 consensus.
Probab=93.49  E-value=0.094  Score=31.37  Aligned_cols=32  Identities=28%  Similarity=0.509  Sum_probs=22.8

Q ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHCCCEEE
Q ss_conf             88189866687789678999999981783562
Q gi|254780457|r    7 QSIIIAIDGTAAAGKGVLSRFIALEYGFHYLD   38 (217)
Q Consensus         7 k~~iIaIDGpagsGKsT~ak~lA~~l~~~~ld   38 (217)
T Consensus       430 ~~~~vLLhG~~g~GK~t~V~~vas~lg~h~~e  461 (953)
T KOG0736         430 LNPSVLLHGPPGSGKTTVVRAVASELGLHLLE  461 (953)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHCCCEEE
T ss_conf             55379986799987579999999983872570