HHsearch alignment for GI: 254780457 and conserved domain: KOG3078

>KOG3078 consensus.
Probab=97.11  E-value=0.00035  Score=45.91  Aligned_cols=40  Identities=20%  Similarity=0.375  Sum_probs=36.7

Q ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHCCCEEECCHHHHHH
Q ss_conf             8818986668778967899999998178356202899999
Q gi|254780457|r    7 QSIIIAIDGTAAAGKGVLSRFIALEYGFHYLDTGLIYRAV   46 (217)
Q Consensus         7 k~~iIaIDGpagsGKsT~ak~lA~~l~~~~ldtG~~YR~~   46 (217)
T Consensus        14 ~~~~~v~~G~pg~gkgt~a~~l~~~~~~~hl~tGdllr~~   53 (235)
T KOG3078          14 KGVRAVLLGAPGSGKGTQAPRLTKNFGVIHISTGDLLRDE   53 (235)
T ss_pred             CCEEEEEEECCCCCCCCCCHHHHHHCCCCCCHHHHHHHHH
T ss_conf             4647999718999977437799984477500347889999