HHsearch alignment for GI: 254780457 and conserved domain: KOG3354

>KOG3354 consensus.
Probab=99.21  E-value=1.9e-09  Score=77.33  Aligned_cols=169  Identities=17%  Similarity=0.280  Sum_probs=97.8

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHHCCCEEECCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCC--------CC
Q ss_conf             1898666877896789999999817835620289999985232101110146553333210111244444--------43
Q gi|254780457|r    9 IIIAIDGTAAAGKGVLSRFIALEYGFHYLDTGLIYRAVAKNILDAGISLDDEKMAIKIAQNIVLSNLDKA--------QL   80 (217)
Q Consensus         9 ~iIaIDGpagsGKsT~ak~lA~~l~~~~ldtG~~YR~~a~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~--------~l   80 (217)
T Consensus        13 ~~i~vmGvsGsGKSTigk~L~~~l~~~F~dg---------------Dd~Hp~~NveKM~~GipLnD~DR~pWL~~i~~~~   77 (191)
T KOG3354          13 YVIVVMGVSGSGKSTIGKALSEELGLKFIDG---------------DDLHPPANVEKMTQGIPLNDDDRWPWLKKIAVEL   77 (191)
T ss_pred             EEEEEEECCCCCHHHHHHHHHHHHCCCCCCC---------------CCCCCHHHHHHHHCCCCCCCCCCCHHHHHHHHHH
T ss_conf             0599983588774459999999858862455---------------5579878899883699888532117999999999


Q ss_pred             CCHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEECCCHHHHHHCCCCEE-EEEECCHHHHHHHHHHHHHHHHCCC
Q ss_conf             201210011112205789999887888876303884620641255663038868-9984488889999866776521113
Q gi|254780457|r   81 SSNAIANVASQVASIDSVRDALIDIQRSFAQNKLGVILDGRDIGTIIFPDARIK-FYVTASLDIRARRRYNEMVSRGEKV  159 (217)
Q Consensus        81 r~~~I~~~~S~iA~~p~VR~~l~~~Qr~~~~~~~g~V~EGRDigTvVfPdA~~K-ifL~As~e~RA~RR~~el~~~g~~~  159 (217)
T Consensus        78 ~~~l~~~q~vVlAC-----SaLKk~YRdILr~---sl~~gk---~~~~~~~~l~fi~l~~s~evi~~Rl----~~R~gHF  142 (191)
T KOG3354          78 RKALASGQGVVLAC-----SALKKKYRDILRH---SLKDGK---PGKCPESQLHFILLSASFEVILKRL----KKRKGHF  142 (191)
T ss_pred             HHHHHCCCEEEEEH-----HHHHHHHHHHHHH---HCCCCC---CCCCCCCEEEEEEEECCHHHHHHHH----HHCCCCC
T ss_conf             98763278189972-----8888999999973---211478---6678640588863304299999998----4066666


Q ss_pred             CHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHHHHH
Q ss_conf             5699999999985610236757853799739997789898999999999999874
Q gi|254780457|r  160 DYVKILEDLRNRDNQDRNRSYCPLVRDKDAYFFDTSEMDIGTMCKVAKGLIDTKL  214 (217)
Q Consensus       160 ~~~ev~~~i~~RD~~D~~R~~sPL~~a~DAi~IDTs~lsi~ev~~~i~~~I~~kl  214 (217)
T Consensus       143 Mp~~lleSQf~----~---LE~p~~~e~div~isv~~~~~e~iv~tI~k~~~~~~  190 (191)
T KOG3354         143 MPADLLESQFA----T---LEAPDADEEDIVTISVKTYSVEEIVDTIVKMVALNI  190 (191)
T ss_pred             CCHHHHHHHHH----H---CCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHC
T ss_conf             88789998887----5---269999824668886034789999999999998533