HHsearch alignment for GI: 254780457 and conserved domain: PRK00023

>PRK00023 cmk cytidylate kinase; Provisional.
Probab=100.00  E-value=0  Score=509.13  Aligned_cols=210  Identities=41%  Similarity=0.746  Sum_probs=195.1

Q ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHCCCEEECCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHC-------------C
Q ss_conf             558818986668778967899999998178356202899999852321011101465533332101-------------1
Q gi|254780457|r    5 ESQSIIIAIDGTAAAGKGVLSRFIALEYGFHYLDTGLIYRAVAKNILDAGISLDDEKMAIKIAQNI-------------V   71 (217)
Q Consensus         5 ~~k~~iIaIDGpagsGKsT~ak~lA~~l~~~~ldtG~~YR~~a~~~~~~~~~~~~~~~~~~~~~~i-------------~   71 (217)
T Consensus         1 m~~~iIIaIDGpagSGKST~ak~lA~~L~~~yldTG~~YRa~a~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~v~   80 (225)
T PRK00023          1 MMKAPVIAIDGPAGSGKGTVAKILAKKLGFHYLDTGAMYRAVALAALQHGVDLEDEEALVALAAHLDISFENGPDGQEVF   80 (225)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEECHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCCCCCCCCEEE
T ss_conf             99897899658986787899999999939887641099999999999848596579999999854982003688763798


Q ss_pred             CCCCC-CCCCCCHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEECCCHHHHHHCCCCEEEEEECCHHHHHHHHHH
Q ss_conf             12444-44432012100111122057899998878888763038846206412556630388689984488889999866
Q gi|254780457|r   72 LSNLD-KAQLSSNAIANVASQVASIDSVRDALIDIQRSFAQNKLGVILDGRDIGTIIFPDARIKFYVTASLDIRARRRYN  150 (217)
Q Consensus        72 ~~~~~-~~~lr~~~I~~~~S~iA~~p~VR~~l~~~Qr~~~~~~~g~V~EGRDigTvVfPdA~~KifL~As~e~RA~RR~~  150 (217)
T Consensus        81 l~~~dv~~~lrs~eI~~~vS~iA~~~~VR~~l~~~Qr~~~~~-~g~V~eGRDIGTvVfPdA~lK~fL~As~~~RA~RR~~  159 (225)
T PRK00023         81 LNGEDVSDEIRTEEVGNAASKVAAIPEVREALVERQRAFAEA-PGLVMDGRDIGTVVFPDAELKIFLTASAEERAERRYK  159 (225)
T ss_pred             ECCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHC-CCEEEECCCCCEEEECCCCEEEEEECCHHHHHHHHHH
T ss_conf             679512798822788888988638788999999999999853-6916742543138806887677786798999999999


Q ss_pred             HHHHHHCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             77652111356999999999856102367578537997399977898989999999999998740
Q gi|254780457|r  151 EMVSRGEKVDYVKILEDLRNRDNQDRNRSYCPLVRDKDAYFFDTSEMDIGTMCKVAKGLIDTKLD  215 (217)
Q Consensus       151 el~~~g~~~~~~ev~~~i~~RD~~D~~R~~sPL~~a~DAi~IDTs~lsi~ev~~~i~~~I~~kl~  215 (217)
T Consensus       160 el~~~g~~~~~~~v~~~i~~RD~~D~~R~~sPL~~a~DAi~IDts~lti~evv~~i~~~i~~ki~  224 (225)
T PRK00023        160 ELQAKGISVNFEDLLAEIKERDERDSNRAVAPLKPAEDALLLDTSGLSIEEVVEKILALIEQKLA  224 (225)
T ss_pred             HHHHCCCCCCHHHHHHHHHHHCHHHCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHHHHHC
T ss_conf             99875887779999999986342023377678754898189989899999999999999999864