HHsearch alignment for GI: 254780457 and conserved domain: PRK03846

>PRK03846 adenylylsulfate kinase; Provisional.
Probab=99.27  E-value=2.5e-10  Score=82.61  Aligned_cols=167  Identities=14%  Similarity=0.184  Sum_probs=98.5

Q ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHHHCC-----CEEECCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             5558818986668778967899999998178-----35620289999985232101110146553333210111244444
Q gi|254780457|r    4 LESQSIIIAIDGTAAAGKGVLSRFIALEYGF-----HYLDTGLIYRAVAKNILDAGISLDDEKMAIKIAQNIVLSNLDKA   78 (217)
Q Consensus         4 ~~~k~~iIaIDGpagsGKsT~ak~lA~~l~~-----~~ldtG~~YR~~a~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~   78 (217)
T Consensus        20 ~~~kg~viWlTGLSGSGKTTlA~~L~~~L~~~~~~~~~LD-GD~lR~~--l~~dlgfs~~dR~~n~~r~~~la------k   90 (198)
T PRK03846         20 HGHKGVVLWFTGLSGSGKSTVAGALEEALHELGVHTYLLD-GDNVRHG--LCSDLGFSDADRKENIRRVGEVA------K   90 (198)
T ss_pred             HCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEC-HHHHHHH--HCCCCCCCHHHHHHHHHHHHHHH------H
T ss_conf             6899869998799999889999999999997599759977-7999874--36678989999999999999999------9


Q ss_pred             CCCCHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEECCCHHHHHHCCCCE-EEEEECCHHHHHHHHHHHHHHHHC
Q ss_conf             4320121001111220578999988788887630388462064125566303886-899844888899998667765211
Q gi|254780457|r   79 QLSSNAIANVASQVASIDSVRDALIDIQRSFAQNKLGVILDGRDIGTIIFPDARI-KFYVTASLDIRARRRYNEMVSRGE  157 (217)
Q Consensus        79 ~lr~~~I~~~~S~iA~~p~VR~~l~~~Qr~~~~~~~g~V~EGRDigTvVfPdA~~-KifL~As~e~RA~RR~~el~~~g~  157 (217)
T Consensus        91 ~l~~~G~iVIvs~Isp~~~~R~~~R----~~------------------~~~~~f~EIyl~~~le~c~~RD~KgLY~ka-  147 (198)
T PRK03846         91 LMVDAGLVVLTAFISPHRAERQMVR----ER------------------LGEGEFIEVFVDTPLAICEARDPKGLYKKA-  147 (198)
T ss_pred             HHHHCCCEEEECCCCCCHHHHHHHH----HH------------------CCCCCEEEEEECCCHHHHHHCCCHHHHHHH-
T ss_conf             9985898366414788799999999----86------------------787757999943889999873816578898-


Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCE-EEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             13569999999998561023675785379973-999778989899999999999987
Q gi|254780457|r  158 KVDYVKILEDLRNRDNQDRNRSYCPLVRDKDA-YFFDTSEMDIGTMCKVAKGLIDTK  213 (217)
Q Consensus       158 ~~~~~ev~~~i~~RD~~D~~R~~sPL~~a~DA-i~IDTs~lsi~ev~~~i~~~I~~k  213 (217)
T Consensus       148 -----------~~gei~n~~Gvd~pyE~P~~pdl~Idt~~~si~~~~~~I~~~l~~~  193 (198)
T PRK03846        148 -----------RAGEIKNFTGIDSPYEAPESPEIHLDTGEQLVTNLVEQLLDYLRQR  193 (198)
T ss_pred             -----------HCCCCCCCEECCCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHHHC
T ss_conf             -----------6588888400788999999980698699999999999999999986