HHsearch alignment for GI: 254780457 and conserved domain: PRK04040

>PRK04040 adenylate kinase; Provisional.
Probab=97.68  E-value=0.00029  Score=46.41  Aligned_cols=160  Identities=20%  Similarity=0.245  Sum_probs=89.0

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHH--CCCEEECCHHHHHHHHHHHHCC-CCHHHHHHHHHHHHHCCCCCCCCCCCCCHHH
Q ss_conf             189866687789678999999981--7835620289999985232101-1101465533332101112444444320121
Q gi|254780457|r    9 IIIAIDGTAAAGKGVLSRFIALEY--GFHYLDTGLIYRAVAKNILDAG-ISLDDEKMAIKIAQNIVLSNLDKAQLSSNAI   85 (217)
Q Consensus         9 ~iIaIDGpagsGKsT~ak~lA~~l--~~~~ldtG~~YR~~a~~~~~~~-~~~~~~~~~~~~~~~i~~~~~~~~~lr~~~I   85 (217)
T Consensus         3 k~VvvtGiPGvGKTTv~~~~~~~l~~~~~~vn~G~~M~e~A~~~---glv~~RDe--mRk----L~~-------------   60 (189)
T PRK04040          3 KVVVVTGVPGVGKTTVLNKALEKLKEDYKIVNFGDVMLEVAKEE---GLVEHRDE--MRK----LPL-------------   60 (189)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEHHHHHHHHHHHC---CCCCCHHH--HCC----CCH-------------
T ss_conf             18999758988789999999997235875986779999999981---77347788--747----999-------------


Q ss_pred             HCCCCCCCHHHHHHHHHHHHHHHHHH---H---CCCEEEECCC-----HHHH-HHC-------CCCEEEEEECCHHHHHH
Q ss_conf             00111122057899998878888763---0---3884620641-----2556-630-------38868998448888999
Q gi|254780457|r   86 ANVASQVASIDSVRDALIDIQRSFAQ---N---KLGVILDGRD-----IGTI-IFP-------DARIKFYVTASLDIRAR  146 (217)
Q Consensus        86 ~~~~S~iA~~p~VR~~l~~~Qr~~~~---~---~~g~V~EGRD-----igTv-VfP-------dA~~KifL~As~e~RA~  146 (217)
T Consensus        61 --------------~~q~~lQ~~Aa~~I~~~~~~~~ViIDTHa~Iktp~GylpGLP~~Vl~~L~P~~ivlieA~P~eIl~  126 (189)
T PRK04040         61 --------------EEQKELQREAAERIAEMAGEGPVIVDTHATIKTPGGYLPGLPEWVLEELNPDVIVLIEADPDEILM  126 (189)
T ss_pred             --------------HHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCHHHHHHCCCCEEEEEECCHHHHHH
T ss_conf             --------------999999999999999835787289944520026886778998999986699889999758899999


Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCC----CCCCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             98667765211135699999999985610236757----853799739997789898999999999999
Q gi|254780457|r  147 RRYNEMVSRGEKVDYVKILEDLRNRDNQDRNRSYC----PLVRDKDAYFFDTSEMDIGTMCKVAKGLID  211 (217)
Q Consensus       147 RR~~el~~~g~~~~~~ev~~~i~~RD~~D~~R~~s----PL~~a~DAi~IDTs~lsi~ev~~~i~~~I~  211 (217)
T Consensus       127 RR~~D~tR~RD~es~~~I~~------hq~~nR~~a~ayavltga~-Vkiv~N~e~~~e~Aa~~iv~~l~  188 (189)
T PRK04040        127 RRLRDPTRRRDVETEESIEE------HQEMNRAAAMAYAVLTGAT-VKIVENHEGLLEEAAEEIVEVLR  188 (189)
T ss_pred             HHHCCCCCCCCCCCHHHHHH------HHHHHHHHHHHHHHHHCCE-EEEEECCCCCHHHHHHHHHHHHH
T ss_conf             88425566898788999999------9999999999999973984-89997899988999999999861