HHsearch alignment for GI: 254780457 and conserved domain: PRK05057

>PRK05057 aroK shikimate kinase I; Reviewed.
Probab=99.27  E-value=1.2e-09  Score=78.50  Aligned_cols=155  Identities=15%  Similarity=0.240  Sum_probs=84.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEECCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHCCC
Q ss_conf             89866687789678999999981783562028999998523210111014655333321011124444443201210011
Q gi|254780457|r   10 IIAIDGTAAAGKGVLSRFIALEYGFHYLDTGLIYRAVAKNILDAGISLDDEKMAIKIAQNIVLSNLDKAQLSSNAIANVA   89 (217)
Q Consensus        10 iIaIDGpagsGKsT~ak~lA~~l~~~~ldtG~~YR~~a~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~lr~~~I~~~~   89 (217)
T Consensus         6 nI~LiG~mGsGKstvgk~LA~~l~~~fiD~D~~Ie~------~~g~si~~If---~~~----------------------   54 (172)
T PRK05057          6 NIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEK------RTGADIGWVF---DVE----------------------   54 (172)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHCCCEEECHHHHHH------HHCCCHHHHH---HHH----------------------
T ss_conf             289889999988999999999969996878099999------9798999999---997----------------------


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHC-------CCEEEECCCHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHH--CCCC
Q ss_conf             112205789999887888876303-------8846206412556630388689984488889999866776521--1135
Q gi|254780457|r   90 SQVASIDSVRDALIDIQRSFAQNK-------LGVILDGRDIGTIIFPDARIKFYVTASLDIRARRRYNEMVSRG--EKVD  160 (217)
Q Consensus        90 S~iA~~p~VR~~l~~~Qr~~~~~~-------~g~V~EGRDigTvVfPdA~~KifL~As~e~RA~RR~~el~~~g--~~~~  160 (217)
T Consensus        55 ----Ge~~FR~~E~~~l~~l~~~~~~VIstGGG~v~~~-~~~~-~L~~~g~vv~L~~~~~~~~~R~~-~~~~RPll~~~~  127 (172)
T PRK05057         55 ----GEEGFRDREEKVINELTEKQGIVLATGGGSVKSR-ETRN-RLSARGVVVYLETTIEKQLARTQ-RDKKRPLLQVDD  127 (172)
T ss_pred             ----HHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCH-HHHH-HHHHCCEEEEEECCHHHHHHHHC-CCCCCCCCCCCC
T ss_conf             ----4999999999999988547997997898535889-9999-99966958999599899999805-899999798998


Q ss_pred             HHHHHHHH-HHHHHHCCCCCCCCCC-CCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             69999999-9985610236757853-7997399977898989999999999998
Q gi|254780457|r  161 YVKILEDL-RNRDNQDRNRSYCPLV-RDKDAYFFDTSEMDIGTMCKVAKGLIDT  212 (217)
Q Consensus       161 ~~ev~~~i-~~RD~~D~~R~~sPL~-~a~DAi~IDTs~lsi~ev~~~i~~~I~~  212 (217)
T Consensus       128 ~~~~~~~l~~~R~---------~~Y~~~Ad-~~I~td~~~~~~i~~~Ii~~L~~  171 (172)
T PRK05057        128 PREVLEALANERN---------PLYEEIAD-VTVRTDDQSAKVVANQIIHMLES  171 (172)
T ss_pred             HHHHHHHHHHHHH---------HHHHHHCC-EEEECCCCCHHHHHHHHHHHHHC
T ss_conf             7999999999999---------99998699-99989999999999999999960