HHsearch alignment for GI: 254780457 and conserved domain: PRK05439

>PRK05439 pantothenate kinase; Provisional.
Probab=97.19  E-value=0.0014  Score=42.26  Aligned_cols=136  Identities=20%  Similarity=0.309  Sum_probs=67.0

Q ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHCCC-------EEEC-CHHHHHHHHH---HH-HCC-CCHHHHHHHHHHHHHCC
Q ss_conf             5588189866687789678999999981783-------5620-2899999852---32-101-11014655333321011
Q gi|254780457|r    5 ESQSIIIAIDGTAAAGKGVLSRFIALEYGFH-------YLDT-GLIYRAVAKN---IL-DAG-ISLDDEKMAIKIAQNIV   71 (217)
Q Consensus         5 ~~k~~iIaIDGpagsGKsT~ak~lA~~l~~~-------~ldt-G~~YR~~a~~---~~-~~~-~~~~~~~~~~~~~~~i~   71 (217)
T Consensus        83 ~~~PfIIGIaGSVAVGKSTtARlLq~LL~r~~~~~~V~LvTTDGFLypNa~L~~rglm~RKGFPESYD~~~Ll~Fl~~vK  162 (312)
T PRK05439         83 QKVPFIIGIAGSVAVGKSTTARLLQALLSRWPEHPKVDLVTTDGFLYPNAELKERGLMKRKGFPESYDMRALLRFLSDVK  162 (312)
T ss_pred             CCCCEEEEEEEEEECCHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             89998999762010262889999999995078999458993466557868998767712478985447999999999997


Q ss_pred             CCCCC-CCCCCCHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEECC-------CHHHHHH-CC-CCEEEEEECCH
Q ss_conf             12444-444320121001111220578999988788887630388462064-------1255663-03-88689984488
Q gi|254780457|r   72 LSNLD-KAQLSSNAIANVASQVASIDSVRDALIDIQRSFAQNKLGVILDGR-------DIGTIIF-PD-ARIKFYVTASL  141 (217)
Q Consensus        72 ~~~~~-~~~lr~~~I~~~~S~iA~~p~VR~~l~~~Qr~~~~~~~g~V~EGR-------DigTvVf-Pd-A~~KifL~As~  141 (217)
T Consensus       163 sG~~~v~aPvYSH~~YDIvp--------------~~~~~v~~PDILIvEGlNvLQ~~~~~~~~~~vSDffDfSIYvDA~~  228 (312)
T PRK05439        163 SGKPNVKAPVYSHLIYDIVP--------------GEYQTVDQPDILIVEGLNVLQTGDDDNHRLFVSDFFDFSIYVDADE  228 (312)
T ss_pred             CCCCCCCCEEECHHHHHCCC--------------CCEEEECCCCEEEEECHHHCCCCCCCCCCCCCCCCEEEEEEEECCH
T ss_conf             69987664033367764279--------------9706973799899915121447976788655224313899960888


Q ss_pred             HHHH---HHHHHHHHH
Q ss_conf             8899---998667765
Q gi|254780457|r  142 DIRA---RRRYNEMVS  154 (217)
Q Consensus       142 e~RA---~RR~~el~~  154 (217)
T Consensus       229 ~~Ie~WYi~RFl~L~~  244 (312)
T PRK05439        229 DLIEKWYIERFLKLRE  244 (312)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             8999999999999999