HHsearch alignment for GI: 254780457 and conserved domain: PRK11331

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional.
Probab=96.19  E-value=0.0035  Score=39.95  Aligned_cols=33  Identities=27%  Similarity=0.340  Sum_probs=26.1

Q ss_pred             CCCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCC
Q ss_conf             7655588189866687789678999999981783
Q gi|254780457|r    2 GRLESQSIIIAIDGTAAAGKGVLSRFIALEYGFH   35 (217)
Q Consensus         2 ~~~~~k~~iIaIDGpagsGKsT~ak~lA~~l~~~   35 (217)
T Consensus       189 ~sLktKknvI-L~G~pGtGKT~lAk~lA~~l~g~  221 (459)
T PRK11331        189 KRLTIKKNII-LQGPPGVGKTFVARRLAYLLTGE  221 (459)
T ss_pred             HHHCCCCCEE-EECCCCCCHHHHHHHHHHHHHCC
T ss_conf             9854588279-65899988789999999997078