HHsearch alignment for GI: 254780457 and conserved domain: PRK13631

>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional.
Probab=96.11  E-value=0.0049  Score=39.07  Aligned_cols=103  Identities=12%  Similarity=0.125  Sum_probs=63.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCEEEECCCHHHHHHCCC-------CEEEEEECCHHHHHHHHHHHHHHHHCCC-CHHHHH
Q ss_conf             05789999887888876303884620641255663038-------8689984488889999866776521113-569999
Q gi|254780457|r   94 SIDSVRDALIDIQRSFAQNKLGVILDGRDIGTIIFPDA-------RIKFYVTASLDIRARRRYNEMVSRGEKV-DYVKIL  165 (217)
Q Consensus        94 ~~p~VR~~l~~~Qr~~~~~~~g~V~EGRDigTvVfPdA-------~~KifL~As~e~RA~RR~~el~~~g~~~-~~~ev~  165 (217)
T Consensus       207 LDp~~~~~i~~li~~l~~~g~TiilvTHdm~~v~-~~aDrviVm~~GkIv~~Gtp~ei-F~~~~~l~~~~l~~P~~~~l~  284 (320)
T PRK13631        207 LDPKGEHEMMQLILDAKANNKTVFVITHTMEHVL-EVADEVIVMDKGKILKTGTPYEI-FTDQHIINSTSIQVPRVIQVI  284 (320)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHH-HHCCEEEEEECCEEEEECCHHHH-HCCHHHHHHCCCCCCCHHHHH
T ss_conf             9989999999999999962999999947899999-97999999989889997588998-659999997799999299999


Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             9999985610236757853799739997789898999999999999
Q gi|254780457|r  166 EDLRNRDNQDRNRSYCPLVRDKDAYFFDTSEMDIGTMCKVAKGLID  211 (217)
Q Consensus       166 ~~i~~RD~~D~~R~~sPL~~a~DAi~IDTs~lsi~ev~~~i~~~I~  211 (217)
T Consensus       285 ~~L~~~g~~~~-------------~~~~~~~~~~~~l~~~~~~~~~  317 (320)
T PRK13631        285 NDLIKKDPKYK-------------KLYQKQPRTIEQLADAINEFIK  317 (320)
T ss_pred             HHHHHCCCCCH-------------HHCCCCCCCHHHHHHHHHHHHC
T ss_conf             99997399833-------------3047886469999999999862