HHsearch alignment for GI: 254780457 and conserved domain: PRK13640

>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional.
Probab=96.18  E-value=0.0039  Score=39.66  Aligned_cols=97  Identities=11%  Similarity=0.043  Sum_probs=47.6

Q ss_pred             HHHHHHHHHHHHHHHHHHH-CCCEEEECCCHHHHHHCCCCEEEE-------EECCHHHHHHHHHHHHHHHHCCC-CHHHH
Q ss_conf             0578999988788887630-388462064125566303886899-------84488889999866776521113-56999
Q gi|254780457|r   94 SIDSVRDALIDIQRSFAQN-KLGVILDGRDIGTIIFPDARIKFY-------VTASLDIRARRRYNEMVSRGEKV-DYVKI  164 (217)
Q Consensus        94 ~~p~VR~~l~~~Qr~~~~~-~~g~V~EGRDigTvVfPdA~~Kif-------L~As~e~RA~RR~~el~~~g~~~-~~~ev  164 (217)
T Consensus       175 LD~~~~~~i~~~l~~l~~e~g~TvI~itHd~~~a--~~aDrv~vm~~G~iv~~G~p~ev-f~~~~~l~~~~l~~P~~~~l  251 (283)
T PRK13640        175 LDPAGKEQILKLIRKLMKDNNLTIISITHDIDEA--AGADQVLVLDDGKLLAQGSPVEI-FPKVELLKRIGLDIPFVYKL  251 (283)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCEEEEEEECHHHH--HHCCEEEEEECCEEEEECCHHHH-HCCHHHHHHCCCCCCHHHHH
T ss_conf             8989999999999999970698999997887899--70998999999999997778998-57999999779999969999


Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             9999998561023675785379973999778989899999999999
Q gi|254780457|r  165 LEDLRNRDNQDRNRSYCPLVRDKDAYFFDTSEMDIGTMCKVAKGLI  210 (217)
Q Consensus       165 ~~~i~~RD~~D~~R~~sPL~~a~DAi~IDTs~lsi~ev~~~i~~~I  210 (217)
T Consensus       252 ~~~L~~~g-----------------~~~~~~~~t~eel~~~l~~~~  280 (283)
T PRK13640        252 KLKLKEKG-----------------ISVPQEINTEEKLVQYLCQLN  280 (283)
T ss_pred             HHHHHHCC-----------------CCCCCCCCCHHHHHHHHHHHH
T ss_conf             99999749-----------------999988789999999999875