HHsearch alignment for GI: 254780457 and conserved domain: PRK13642

>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional.
Probab=96.23  E-value=0.0034  Score=40.03  Aligned_cols=97  Identities=12%  Similarity=0.130  Sum_probs=47.9

Q ss_pred             CHHHHHHHHHHHHHHHHHHHC-CCEEEECCCHHHHHHCCCCEEEEEE-------CCHHHHHHHHHHHHHHHHCCCC-HHH
Q ss_conf             205789999887888876303-8846206412556630388689984-------4888899998667765211135-699
Q gi|254780457|r   93 ASIDSVRDALIDIQRSFAQNK-LGVILDGRDIGTIIFPDARIKFYVT-------ASLDIRARRRYNEMVSRGEKVD-YVK  163 (217)
Q Consensus        93 A~~p~VR~~l~~~Qr~~~~~~-~g~V~EGRDigTvVfPdA~~KifL~-------As~e~RA~RR~~el~~~g~~~~-~~e  163 (217)
T Consensus       170 ~LD~~~~~~i~~ll~~L~~~~~~Tii~iTHdl~~~~~--aDrv~vm~~G~Iv~~G~~~e-vf~~p~~l~~~~l~~P~~~~  246 (277)
T PRK13642        170 MLDPTGRSEIMRVIHEIKDKYHLTVLSITHDLDEAAS--SDRILVMRAGEIIKEAAPSE-LFATSEDMVEIGLDVPFSSN  246 (277)
T ss_pred             CCCHHHHHHHHHHHHHHHHHCCCEEEEEEECHHHHHH--CCEEEEEECCEEEEECCHHH-HHCCHHHHHHCCCCCCHHHH
T ss_conf             5898999999999999998169899999458899971--99899998999999768999-87696779877999987999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHH
Q ss_conf             9999999856102367578537997399977898989999999999
Q gi|254780457|r  164 ILEDLRNRDNQDRNRSYCPLVRDKDAYFFDTSEMDIGTMCKVAKGL  209 (217)
Q Consensus       164 v~~~i~~RD~~D~~R~~sPL~~a~DAi~IDTs~lsi~ev~~~i~~~  209 (217)
T Consensus       247 l~~~L~~~-----------------g~~~~~~~~t~~e~~~~l~~~  275 (277)
T PRK13642        247 LMKDLRTN-----------------GFDLPEKYLSEDELVELLADK  275 (277)
T ss_pred             HHHHHHHC-----------------CCCCCCCCCCHHHHHHHHHHH
T ss_conf             99999975-----------------998998875999999999986