HHsearch alignment for GI: 254780457 and conserved domain: PTZ00301

>PTZ00301 uridine kinase; Provisional.
Probab=99.37  E-value=9e-12  Score=91.23  Aligned_cols=189  Identities=17%  Similarity=0.190  Sum_probs=109.1

Q ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHCC-------CEEECCHHHHHHHHHHHH--CCCCHH-----HHHHHHHHHHHCC
Q ss_conf             58818986668778967899999998178-------356202899999852321--011101-----4655333321011
Q gi|254780457|r    6 SQSIIIAIDGTAAAGKGVLSRFIALEYGF-------HYLDTGLIYRAVAKNILD--AGISLD-----DEKMAIKIAQNIV   71 (217)
Q Consensus         6 ~k~~iIaIDGpagsGKsT~ak~lA~~l~~-------~~ldtG~~YR~~a~~~~~--~~~~~~-----~~~~~~~~~~~i~   71 (217)
T Consensus         1 m~~~iIgIaGgSgSGKTT~a~~i~~~l~~~~~~~~v~ii~~D~Yy~d~~~~~~~~~~~~NfDhP~a~D~dLl~~~L~~Lk   80 (210)
T PTZ00301          1 MPCTVIGISGASGSGKSSLSTNIVSELMAHCGPVSIGVICEDFYYRDQSNIPESERAYTNYDHPKSLEHDLLTTHLRELK   80 (210)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCHHHCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             99889999688767899999999999876149980799836766778765886562788999823036999999999997


Q ss_pred             CCCCCCCCCCCHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEECCCHHHHHHCC------CCEEEEEECCHHHHH
Q ss_conf             12444444320121001111220578999988788887630388462064125566303------886899844888899
Q gi|254780457|r   72 LSNLDKAQLSSNAIANVASQVASIDSVRDALIDIQRSFAQNKLGVILDGRDIGTIIFPD------ARIKFYVTASLDIRA  145 (217)
Q Consensus        72 ~~~~~~~~lr~~~I~~~~S~iA~~p~VR~~l~~~Qr~~~~~~~g~V~EGRDigTvVfPd------A~~KifL~As~e~RA  145 (217)
T Consensus        81 ~G----k~I~~P~Ydf-----~~h--~R~---~~~~~-i~p~~vIIvEG----i~~l~~~~lr~l~DlkIFvd~~~dirl  141 (210)
T PTZ00301         81 SG----KTVQIPQYDY-----VHH--TRS---DTAVT-MTPKSVLIVEG----ILLFTNAELRNEMDCLIFVDTPLDICL  141 (210)
T ss_pred             CC----CCEECCCCCC-----CCC--CCC---CCEEE-ECCCCEEEEEE----EHHCCCHHHHHHHCEEEEECCCHHHHH
T ss_conf             69----9634466555-----677--667---97089-66885699971----043078989977424577348723788


Q ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHC
Q ss_conf             99866776521113569999999998561023675785379973999778989899999999999987406
Q gi|254780457|r  146 RRRYNEMVSRGEKVDYVKILEDLRNRDNQDRNRSYCPLVRDKDAYFFDTSEMDIGTMCKVAKGLIDTKLDN  216 (217)
Q Consensus       146 ~RR~~el~~~g~~~~~~ev~~~i~~RD~~D~~R~~sPL~~a~DAi~IDTs~lsi~ev~~~i~~~I~~kl~n  216 (217)
T Consensus       142 ~RRi~RDv~e-RGr~~e~Vi~qy~~~V~P~~~~fI~P~k~~AD-iIIp~~-~~n~va~~~i~~~i~~~l~~  209 (210)
T PTZ00301        142 IRRAKRDMRE-RGRTFESVIEQYEATVRPMYYAYVEPSKVYAD-IIVPSW-KDNSVAVGVLRAKLNHDLEN  209 (210)
T ss_pred             HHHHHHHHHH-HCCCHHHHHHHHHHHHCCCHHHHCCHHHHCCC-EEECCC-CCCCHHHHHHHHHHHHHHHC
T ss_conf             9988877887-58899999999996623058876805163361-897899-98631999999999999851