HHsearch alignment for GI: 254780457 and conserved domain: TIGR01313

>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family; InterPro: IPR006001 This family of proteins includes thermoresistant and thermosensitve isozymes of gluconate kinase (gluconokinase) in E. coli and other related proteins; members of this family are often named by similarity to the thermostable isozyme. These proteins show homology to shikimate kinases and adenylate kinases but not to gluconate kinases from the FGGY family of carbohydrate kinases (IPR000577 from INTERPRO).; GO: 0016301 kinase activity, 0005975 carbohydrate metabolic process.
Probab=98.68  E-value=1.3e-06  Score=60.32  Aligned_cols=154  Identities=19%  Similarity=0.256  Sum_probs=91.3

Q ss_pred             ECCCCCCHHHHHHHHHHHHC-----CCEEECCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHCC
Q ss_conf             66877896789999999817-----8356202899999852321011101465533332101112444444320121001
Q gi|254780457|r   14 DGTAAAGKGVLSRFIALEYG-----FHYLDTGLIYRAVAKNILDAGISLDDEKMAIKIAQNIVLSNLDKAQLSSNAIANV   88 (217)
Q Consensus        14 DGpagsGKsT~ak~lA~~l~-----~~~ldtG~~YR~~a~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~lr~~~I~~~   88 (217)
T Consensus         4 mGvaG~GKs~~a~~l~~~lg~iyPd~~yie---------------GDdLHP~~Ni~KMs~GiPL~DdDR~p---------   59 (175)
T TIGR01313         4 MGVAGSGKSTIASALAHRLGDIYPDAKYIE---------------GDDLHPAANIEKMSRGIPLNDDDRWP---------   59 (175)
T ss_pred             ECCCCCCHHHHHHHHHHHHHHHCCCCCCCC---------------CCCCCCHHHHHHHCCCCCCCCCCCHH---------
T ss_conf             602786288999999998543157887568---------------86667877798731788887012043---------


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHCCCEEEE-------CCCHHH--HHHCCCCEE-EEEECCHHHHHHHHHHHHHHHH-C
Q ss_conf             1112205789999887888876303884620-------641255--663038868-9984488889999866776521-1
Q gi|254780457|r   89 ASQVASIDSVRDALIDIQRSFAQNKLGVILD-------GRDIGT--IIFPDARIK-FYVTASLDIRARRRYNEMVSRG-E  157 (217)
Q Consensus        89 ~S~iA~~p~VR~~l~~~Qr~~~~~~~g~V~E-------GRDigT--vVfPdA~~K-ifL~As~e~RA~RR~~el~~~g-~  157 (217)
T Consensus        60 -----WL~~l~~~~~~~~~~--~~~~~~~~~CSALKr~YRD~LR~s~~~~~~~~~FiyL~~~~~~~~~R-----~~~RkG  127 (175)
T TIGR01313        60 -----WLKNLADALAQAAAK--NKVHLVIITCSALKRKYRDILRSSLEEAEPELHFIYLSGSKEVILKR-----MKSRKG  127 (175)
T ss_pred             -----HHHHHHHHHHHHHHC--CCCCCEEEEEECCHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHH-----HHHCCC
T ss_conf             -----799999999999845--77454478840111355566542202689843788636898999999-----610789


Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCCCCCCCCC-CEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             135699999999985610236757853799-739997789898999999999999
Q gi|254780457|r  158 KVDYVKILEDLRNRDNQDRNRSYCPLVRDK-DAYFFDTSEMDIGTMCKVAKGLID  211 (217)
Q Consensus       158 ~~~~~ev~~~i~~RD~~D~~R~~sPL~~a~-DAi~IDTs~lsi~ev~~~i~~~I~  211 (217)
T Consensus       128 HFMka~m~~SQf~----~---LE~P~~nDE~d~~~vd~~~~-~e~~~~~~~~~v~  174 (175)
T TIGR01313       128 HFMKADMLESQFE----A---LEEPTANDETDVVTVDIDQP-LEAVEEDCLAVVL  174 (175)
T ss_pred             CCCCCHHHHHHHH----H---HCCCCCCCCCCEEEECCCCC-HHHHHHHHHHHHH
T ss_conf             9862047899999----7---27888888854378606886-5789999999982