HHsearch alignment for GI: 254780457 and conserved domain: TIGR02173

>TIGR02173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR011892 Proteins in this family are believed to be cytidylate kinase. Members of this family are found in the archaea and in spirochaetes, and differ considerably from the common bacterial form of cytidylate kinase described by IPR003136 from INTERPRO.; GO: 0004127 cytidylate kinase activity, 0005524 ATP binding, 0006139 nucleobase nucleoside nucleotide and nucleic acid metabolic process.
Probab=100.00  E-value=3e-32  Score=213.56  Aligned_cols=163  Identities=25%  Similarity=0.435  Sum_probs=141.5

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHHCCCEEECCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHCC
Q ss_conf             18986668778967899999998178356202899999852321011101465533332101112444444320121001
Q gi|254780457|r    9 IIIAIDGTAAAGKGVLSRFIALEYGFHYLDTGLIYRAVAKNILDAGISLDDEKMAIKIAQNIVLSNLDKAQLSSNAIANV   88 (217)
Q Consensus         9 ~iIaIDGpagsGKsT~ak~lA~~l~~~~ldtG~~YR~~a~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~lr~~~I~~~   88 (217)
T Consensus         1 M~I~ISGpPGSGktTvA~~lA~~Lsl~~iSaG~i-RelA---~~~Gldl~E~~---------------------------   49 (173)
T TIGR02173         1 MIITISGPPGSGKTTVAKILAEKLSLKLISAGDI-RELA---EKMGLDLAESK---------------------------   49 (173)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHCCCCEECCCHH-HHHH---HHCCCCHHHHH---------------------------
T ss_conf             9788735896864789999998639831202007-8898---64298877734---------------------------


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHCCCEEEECCCHHHHHHC---CCCEEEEEECCHHHHHHHHHHHHHHHHCCCCHHHHH
Q ss_conf             11122057899998878888763038846206412556630---388689984488889999866776521113569999
Q gi|254780457|r   89 ASQVASIDSVRDALIDIQRSFAQNKLGVILDGRDIGTIIFP---DARIKFYVTASLDIRARRRYNEMVSRGEKVDYVKIL  165 (217)
Q Consensus        89 ~S~iA~~p~VR~~l~~~Qr~~~~~~~g~V~EGRDigTvVfP---dA~~KifL~As~e~RA~RR~~el~~~g~~~~~~ev~  165 (217)
T Consensus        50 --~aee~~eIDk~iD~~~~E~A~~~~nvvlEsrlagW~~~~nG~yaD~~iyL~A~levRA~R-----IA~Re~k~~~~A~  122 (173)
T TIGR02173        50 --YAEENPEIDKKIDRRIREIAEKEKNVVLESRLAGWILKKNGEYADVKIYLKAPLEVRARR-----IAKRENKDLTVAL  122 (173)
T ss_pred             --HHCCCCCCCHHHHHHHHHHHCCCCCEEEEEHHHHHHCCCCCCCCCEEEEECCCHHHHHHH-----HHHCCCCCHHHHH
T ss_conf             --430586311675378855430489668852054331157889675678860883332433-----2113688989999


Q ss_pred             HHHHHHHHHCCCC-------CCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             9999985610236-------757853799739997789898999999999999
Q gi|254780457|r  166 EDLRNRDNQDRNR-------SYCPLVRDKDAYFFDTSEMDIGTMCKVAKGLID  211 (217)
Q Consensus       166 ~~i~~RD~~D~~R-------~~sPL~~a~DAi~IDTs~lsi~ev~~~i~~~I~  211 (217)
T Consensus       123 ~~~~~REe~e~rRy~~iYgIDidDlsiYD--LvinT~~~~~~~v~~iv~~ald  173 (173)
T TIGR02173       123 KEIIEREESEKRRYKEIYGIDIDDLSIYD--LVINTSNLDVDEVSDIVLDALD  173 (173)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCEEEE--EEEECCCCCHHHHHHHHHHHCC
T ss_conf             99999887622345665250234322220--0334476681269999998609