HHsearch alignment for GI: 254780457 and conserved domain: cd02020

>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor.
Probab=100.00  E-value=0  Score=376.56  Aligned_cols=147  Identities=44%  Similarity=0.757  Sum_probs=143.4

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEECCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHCCC
Q ss_conf             89866687789678999999981783562028999998523210111014655333321011124444443201210011
Q gi|254780457|r   10 IIAIDGTAAAGKGVLSRFIALEYGFHYLDTGLIYRAVAKNILDAGISLDDEKMAIKIAQNIVLSNLDKAQLSSNAIANVA   89 (217)
Q Consensus        10 iIaIDGpagsGKsT~ak~lA~~l~~~~ldtG~~YR~~a~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~lr~~~I~~~~   89 (217)
T Consensus         1 iIaIdGpagsGKsT~ak~lA~~l~~~~ldtG--------------------------------------~ir~~ev~~~~   42 (147)
T cd02020           1 IIAIDGPAGSGKSTVAKLLAKKLGLPYLDTG--------------------------------------GIRTEEVGKLA   42 (147)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHCCEEECCC--------------------------------------CCCCHHHHHHH
T ss_conf             9888689978989999999999099077665--------------------------------------42548998999


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHCCCEEEECCCHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHCCCCHHHHHHHHH
Q ss_conf             11220578999988788887630388462064125566303886899844888899998667765211135699999999
Q gi|254780457|r   90 SQVASIDSVRDALIDIQRSFAQNKLGVILDGRDIGTIIFPDARIKFYVTASLDIRARRRYNEMVSRGEKVDYVKILEDLR  169 (217)
Q Consensus        90 S~iA~~p~VR~~l~~~Qr~~~~~~~g~V~EGRDigTvVfPdA~~KifL~As~e~RA~RR~~el~~~g~~~~~~ev~~~i~  169 (217)
T Consensus        43 s~ia~~~~VR~~l~~~Qr~~~~~-~~~V~eGRDigtvV~P~A~lKifL~As~e~RA~RR~~e~~~~~~~~~~~~v~~~i~  121 (147)
T cd02020          43 SEVAAIPEVRKALDERQRELAKK-PGIVLEGRDIGTVVFPDADLKIFLTASPEVRAKRRAKQLQAKGEGVDLEEILAEII  121 (147)
T ss_pred             HHHCCCHHHHHHHHHHHHHHHHC-CCEEEECCCCCCEECCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCHHHHHHHHH
T ss_conf             99819788999999999999766-99689713101024467476777758989999999999997577889999999999


Q ss_pred             HHHHHCCCCCCCCCCCCCCEEEEECC
Q ss_conf             98561023675785379973999778
Q gi|254780457|r  170 NRDNQDRNRSYCPLVRDKDAYFFDTS  195 (217)
Q Consensus       170 ~RD~~D~~R~~sPL~~a~DAi~IDTs  195 (217)
T Consensus       122 ~RD~~D~~R~~sPL~~a~dai~IDTs  147 (147)
T cd02020         122 ERDERDSTRYVAPLKLAEDAIVIDTS  147 (147)
T ss_pred             HHHHHHCCCCCCCCCCCCCCEEEECC
T ss_conf             87266557566887789998887193