HHsearch alignment for GI: 254780457 and conserved domain: cd03228

>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export. They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins. The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities. The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.10  E-value=0.0055  Score=38.76  Aligned_cols=31  Identities=26%  Similarity=0.415  Sum_probs=24.1

Q ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHCCCEEECC
Q ss_conf             8818986668778967899999998178356202
Q gi|254780457|r    7 QSIIIAIDGTAAAGKGVLSRFIALEYGFHYLDTG   40 (217)
Q Consensus         7 k~~iIaIDGpagsGKsT~ak~lA~~l~~~~ldtG   40 (217)
T Consensus        27 ~Ge~i~ivG~sGsGKSTLl~ll~gl~~---p~~G   57 (171)
T cd03228          27 PGEKVAIVGPSGSGKSTLLKLLLRLYD---PTSG   57 (171)
T ss_pred             CCCEEEEECCCCCHHHHHHHHHHCCCC---CCCC
T ss_conf             998999999999839999999976775---8974