HHsearch alignment for GI: 254780457 and conserved domain: cd03235

>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters. This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc. The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor. The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri. Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates.
Probab=95.37  E-value=0.015  Score=36.17  Aligned_cols=33  Identities=30%  Similarity=0.312  Sum_probs=25.0

Q ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHCCCEEECCHH
Q ss_conf             881898666877896789999999817835620289
Q gi|254780457|r    7 QSIIIAIDGTAAAGKGVLSRFIALEYGFHYLDTGLI   42 (217)
Q Consensus         7 k~~iIaIDGpagsGKsT~ak~lA~~l~~~~ldtG~~   42 (217)
T Consensus        24 ~Ge~~~liGpNGaGKSTllk~i~G---l~~p~~G~i   56 (213)
T cd03235          24 PGEFLAIVGPNGAGKSTLLKAILG---LLKPTSGSI   56 (213)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHC---CCCCCCCEE
T ss_conf             998999999999869999999976---878897589