HHsearch alignment for GI: 254780457 and conserved domain: pfam00406

>pfam00406 ADK Adenylate kinase.
Probab=98.94  E-value=5.9e-09  Score=74.41  Aligned_cols=110  Identities=24%  Similarity=0.305  Sum_probs=61.6

Q ss_pred             ECCCCCCHHHHHHHHHHHHCCCEEECCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCCC
Q ss_conf             66877896789999999817835620289999985232101110146553333210111244444432012100111122
Q gi|254780457|r   14 DGTAAAGKGVLSRFIALEYGFHYLDTGLIYRAVAKNILDAGISLDDEKMAIKIAQNIVLSNLDKAQLSSNAIANVASQVA   93 (217)
Q Consensus        14 DGpagsGKsT~ak~lA~~l~~~~ldtG~~YR~~a~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~lr~~~I~~~~S~iA   93 (217)
T Consensus         2 ~G~PGsGKgTqa~~La~~~~~~~is~GdllR~~~----~~~s~~g~------~i~~~i~~G----~lvpd~i--------   59 (186)
T pfam00406         2 LGPPGAGKGTQAERIVQKYGIVHLSTGDLLRAEV----KSGTELGK------EAKEYMDKG----ELVPDEV--------   59 (186)
T ss_pred             CCCCCCCHHHHHHHHHHHHCCEEECHHHHHHHHH----HCCCHHHH------HHHHHHHCC----CCCCHHH--------
T ss_conf             1889898599999999985990676999999998----62887999------999999869----9543099--------


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCEEEEC--CCHHHHHH-----C---CCCEEEEEECCHHHHHHHHHH
Q ss_conf             057899998878888763038846206--41255663-----0---388689984488889999866
Q gi|254780457|r   94 SIDSVRDALIDIQRSFAQNKLGVILDG--RDIGTIIF-----P---DARIKFYVTASLDIRARRRYN  150 (217)
Q Consensus        94 ~~p~VR~~l~~~Qr~~~~~~~g~V~EG--RDigTvVf-----P---dA~~KifL~As~e~RA~RR~~  150 (217)
T Consensus        60 ~~~l~~~~l~----~~~-~~~g~iLDGfPRt~~Qa~~l~~~l~~~~~~~~Vi~l~~~~~~~~~Rl~~  121 (186)
T pfam00406        60 VVGLVKERLE----QND-CKNGFLLDGFPRTVPQAEALEEMLEYGIKLDYVIEFDVPDEVLVERLTG  121 (186)
T ss_pred             HHHHHHHHHC----CCC-CCCCEEEECCCCCHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHHC
T ss_conf             9999999970----745-5486687379898999999999997499877799997378999999976