HHsearch alignment for GI: 254780457 and conserved domain: pfam01202

>pfam01202 SKI Shikimate kinase.
Probab=99.08  E-value=1.6e-08  Score=71.86  Aligned_cols=150  Identities=19%  Similarity=0.264  Sum_probs=80.4

Q ss_pred             CCCCHHHHHHHHHHHHCCCEEECCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCCCHHH
Q ss_conf             77896789999999817835620289999985232101110146553333210111244444432012100111122057
Q gi|254780457|r   17 AAAGKGVLSRFIALEYGFHYLDTGLIYRAVAKNILDAGISLDDEKMAIKIAQNIVLSNLDKAQLSSNAIANVASQVASID   96 (217)
Q Consensus        17 agsGKsT~ak~lA~~l~~~~ldtG~~YR~~a~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~lr~~~I~~~~S~iA~~p   96 (217)
T Consensus         1 mGsGKstigk~LA~~L~~~fiD~D~~ie~~------~g~si~eif~--~~G---------------------------e~   45 (158)
T pfam01202         1 MGAGKTTIGRLLAKALGLPFIDTDQEIEKR------TGMSIAEIFE--EEG---------------------------EE   45 (158)
T ss_pred             CCCCHHHHHHHHHHHHCCCEEECHHHHHHH------HCCCHHHHHH--HHC---------------------------HH
T ss_conf             989779999999999699978872999988------7889999999--819---------------------------89


Q ss_pred             HHHHHHHHHHHHHHHHCCCEEEECCC-----HHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHH--CCCC-HHHHHHHH
Q ss_conf             89999887888876303884620641-----2556630388689984488889999866776521--1135-69999999
Q gi|254780457|r   97 SVRDALIDIQRSFAQNKLGVILDGRD-----IGTIIFPDARIKFYVTASLDIRARRRYNEMVSRG--EKVD-YVKILEDL  168 (217)
Q Consensus        97 ~VR~~l~~~Qr~~~~~~~g~V~EGRD-----igTvVfPdA~~KifL~As~e~RA~RR~~el~~~g--~~~~-~~ev~~~i  168 (217)
T Consensus        46 ~FR~~E~~~l~~l~~~~~~VIstGGG~v~~~~~~~~L~~~g~vi~L~~~~~~i~~Rl~~~-~~RPll~~~~~~~~~~~l~  124 (158)
T pfam01202        46 GFRRLESEVLKELLAEHNAVIATGGGAVLSEENRDLLRENGIVVYLDADPEVLLERLKAD-KTRPLLQDKDPEEELLELL  124 (158)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHCCEEEEEECCHHHHHHHHCCC-CCCCCCCCCCHHHHHHHHH
T ss_conf             999999999999971699499807860258999999995792799849999999997179-9999898998799999999


Q ss_pred             HHHHHHCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             9985610236757853799739997789898999999999999
Q gi|254780457|r  169 RNRDNQDRNRSYCPLVRDKDAYFFDTSEMDIGTMCKVAKGLID  211 (217)
Q Consensus       169 ~~RD~~D~~R~~sPL~~a~DAi~IDTs~lsi~ev~~~i~~~I~  211 (217)
T Consensus       125 ~~R~---------~~Y~~~a~~~i~~~~~~~~ei~~~Ii~~l~  158 (158)
T pfam01202       125 FERC---------PLYEEAADIVVDTDESSPEEVAEEILEALE  158 (158)
T ss_pred             HHHH---------HHHHHHCCEEEECCCCCHHHHHHHHHHHHC
T ss_conf             9999---------999986999987999999999999999759