BLAST/PSIBLAST alignment of GI: 254780457 and GI: 150398643 at iteration 1
>gi|150398643|ref|YP_001329110.1| cytidylate kinase [Sinorhizobium medicae WSM419] Length = 212
>gi|166198998|sp|A6UF45|KCY_SINMW RecName: Full=Cytidylate kinase; Short=CK; AltName: Full=Cytidine monophosphate kinase; Short=CMP kinase Length = 212
>gi|150030158|gb|ABR62275.1| cytidylate kinase [Sinorhizobium medicae WSM419] Length = 212
 Score =  231 bits (590), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 111/210 (52%), Positives = 150/210 (71%)

Query: 8   SIIIAIDGTAAAGKGVLSRFIALEYGFHYLDTGLIYRAVAKNILDAGISLDDEKMAIKIA 67
           S ++AIDG AAAGKG LSR IA  YGFH+LDTGL YRA AK ++DAG+ LDDE +A K A
Sbjct: 2   SFVVAIDGPAAAGKGTLSRLIAKRYGFHHLDTGLTYRAAAKALIDAGLPLDDEAVAEKTA 61

Query: 68  QNIVLSNLDKAQLSSNAIANVASQVASIDSVRDALIDIQRSFAQNKLGVILDGRDIGTII 127
           + + LS LD+A LS++AI   AS++A + +VR AL++ QR+FA  + G +LDGRDIGT++
Sbjct: 62  RQVDLSGLDRAVLSAHAIGEAASKIAVMPAVRRALVEAQRAFALKEPGTVLDGRDIGTVV 121

Query: 128 FPDARIKFYVTASLDIRARRRYNEMVSRGEKVDYVKILEDLRNRDNQDRNRSYCPLVRDK 187
            PDA +K YVTAS ++RA+RRY+E+V+ G   DY  I ED++ RD +D  R+  PL   +
Sbjct: 122 CPDAAVKLYVTASPEVRAKRRYDEIVTGGGTADYTTIFEDVKKRDTRDMGRADSPLRPAE 181

Query: 188 DAYFFDTSEMDIGTMCKVAKGLIDTKLDNS 217
           DA+  DTSEM I    + AK LID  L+ +
Sbjct: 182 DAHLLDTSEMSIEAAFQAAKTLIDVALNKT 211