BLAST/PSIBLAST alignment of GI: 254780457 and GI: 227824087 at iteration 1
>gi|227824087|ref|YP_002828060.1| cytidylate kinase [Sinorhizobium fredii NGR234] Length = 210
>gi|227343089|gb|ACP27307.1| cytidylate kinase [Sinorhizobium fredii NGR234] Length = 210
 Score =  229 bits (584), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 149/206 (72%)

Query: 9   IIIAIDGTAAAGKGVLSRFIALEYGFHYLDTGLIYRAVAKNILDAGISLDDEKMAIKIAQ 68
           IIIAIDG AAAGKG LSR IA EYGFH+LDTGL YRA AK +LDAG+ LDDE +A  +A+
Sbjct: 2   IIIAIDGPAAAGKGTLSRRIAEEYGFHHLDTGLTYRATAKALLDAGLPLDDEAVAETMAR 61

Query: 69  NIVLSNLDKAQLSSNAIANVASQVASIDSVRDALIDIQRSFAQNKLGVILDGRDIGTIIF 128
            + L+ LD++ LS++AI   AS++A + +VR AL++ QR F+  + G +LDGRDIGT++ 
Sbjct: 62  EVELAGLDRSVLSAHAIGEAASKIAVMPAVRRALVEAQRGFSLKEPGTVLDGRDIGTVVC 121

Query: 129 PDARIKFYVTASLDIRARRRYNEMVSRGEKVDYVKILEDLRNRDNQDRNRSYCPLVRDKD 188
           PDA +K YVTAS ++RA+RRY+E+++ G + DY  I ED++ RD +D  R+  PL   +D
Sbjct: 122 PDATVKLYVTASPEVRAKRRYDEIIAVGGRADYAAIFEDVKQRDERDMGRADSPLKPAED 181

Query: 189 AYFFDTSEMDIGTMCKVAKGLIDTKL 214
           A+  DTSEM I    + AK LID  L
Sbjct: 182 AHLLDTSEMGIEAAFQAAKTLIDAAL 207