RPSBLAST alignment for GI: 254780457 and conserved domain: TIGR00017

>gnl|CDD|129128 TIGR00017, cmk, cytidylate kinase. This family consists of cytidylate kinase, which catalyzes the phosphorylation of cytidine 5-monophosphate (dCMP) to cytidine 5 -diphosphate (dCDP) in the presence of ATP or GTP. UMP and dCMP can also act as acceptors. Length = 217
 Score =  160 bits (407), Expect = 2e-40
 Identities = 73/211 (34%), Positives = 125/211 (59%), Gaps = 15/211 (7%)

Query: 10  IIAIDGTAAAGKGVLSRFIALEYGFHYLDTGLIYRAVAKNILDAGISLDDEKMAIKIA-- 67
           IIAIDG + AGK  +++ +A + G+ YLD+G +YRA+A   L   + L  E    ++   
Sbjct: 4   IIAIDGPSGAGKSTVAKAVAEKLGYAYLDSGAMYRAIALAALQNRVDLTSEDALAELISH 63

Query: 68  -----------QNIVLSNLD-KAQLSSNAIANVASQVASIDSVRDALIDIQRSFAQNKLG 115
                        + L+  D    + +  +AN AS+VA    VR+AL+  Q++ A+N  G
Sbjct: 64  LDIRFIPTNGEVEVFLNGEDVSEAIRTQEVANAASKVAVFPKVREALLKRQQALAKND-G 122

Query: 116 VILDGRDIGTIIFPDARIKFYVTASLDIRARRRYNEMVSRGEKVDYVKILEDLRNRDNQD 175
           +I DGRDIGT++FP+A +K ++ AS++ RA+RRY ++  +G +V++ ++L +++ RD++D
Sbjct: 123 IIADGRDIGTVVFPNAEVKIFLDASVEERAKRRYKQLQIKGNEVNFEELLAEIKERDDRD 182

Query: 176 RNRSYCPLVRDKDAYFFDTSEMDIGTMCKVA 206
            NR   PL +  DA + DTS + I  + +  
Sbjct: 183 SNREVAPLKKADDALYLDTSNLSIDEVVEKI 213