HHsearch alignment for GI: 254780458 and conserved domain: PRK09369

>PRK09369 UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Validated.
Probab=100.00  E-value=0  Score=637.70  Aligned_cols=409  Identities=19%  Similarity=0.248  Sum_probs=346.2

Q ss_pred             EEEEECCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCCEEEEEC-CEEEEEECCCCCC
Q ss_conf             589706885369998184222899999999744984999779802899999999998497999989-9899981268875
Q gi|254780458|r    9 TIQSSYSCGLQGTICIPGDRSLSHFSIILGGIAAGETQIRGVLESDDVLNTMRMMHYLGARFTKKD-REWIVQGVGNGCL   87 (449)
Q Consensus         9 ~~~~~~~~~L~G~i~vp~SKs~s~RaLl~AaLa~g~s~i~n~~~s~Dv~~~l~al~~LG~~i~~~~-~~~~i~g~g~~~~   87 (449)
T Consensus         3 ~~~I~g~~~L~G~V~vpGsKs~~~~~l~AalLa~G~s~i~n~~~~~D~~~t~~~l~~LG~~i~~~~~~~~~i~~~~~~~~   82 (417)
T PRK09369          3 KLVIEGGKPLSGEVKISGAKNAALPILAASLLADEPVTLTNVPDLSDVETMIELLRSLGAKVERDEGGTLTIDASNINNT   82 (417)
T ss_pred             EEEEECCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHCCCEEEECCCCEEEEECCCCCCC
T ss_conf             69995889716799888848999999999986699399926998589999999999779989985898899978987778


Q ss_pred             CCCCCEEEECCCCCCCCEEEEECCCCCC-EEEECCCCCCCCCCCCCEEEEEEECCCCEEECCCCCCCCEEECCCCCCCEE
Q ss_conf             6853105503333322001343145531-033123333344654210101231274101013432220120222111113
Q gi|254780458|r   88 LSPEYPLDFKGFDMGYGLMMGVVGVYDF-QTFFKGRAEILQPTIESLLAPLYQMGVQVKLPEDKRLPLVLHGPRTPNPIV  166 (449)
Q Consensus        88 ~~~~~~i~~~~sgt~~r~l~~~l~~~~~-~~~i~G~~~l~~Rpi~~li~~L~~lGa~i~~~~~~~~Pi~I~g~~~~~~~~  166 (449)
T Consensus        83 ~~~~~~--~~~~R~sil~lg~Llar~g~~~~~~~Gg~~lg~RPm~~~~~~L~~lGA~i~~-~~g~~~~~~~~~L~g~--~  157 (417)
T PRK09369         83 EAPYEL--VKKMRASILVLGPLLARFGEAKVSLPGGCAIGARPVDLHLKGLEALGAEIEI-EHGYVKAKAAGRLKGA--H  157 (417)
T ss_pred             CCCHHH--HHHHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCHHHHHHHHHCCEEEEC-CCCCEEEEECCCCCCC--C
T ss_conf             699678--6312365887788884169449953798744688728999889748839951-4894799978887676--2


Q ss_pred             EEECCCCCCCCCEEHHHHHCCCCCCCCCCCCCCCCHHHH---HHHHCCCEEEEECCCCCEEEEEECCCCCCCCCCCCCCC
Q ss_conf             430234443320000000000112223465454424444---66544973444113331002675286510233200232
Q gi|254780458|r  167 YKSPMDSVQSKSVVLLAGLNTPGITEVIEPVKTQDHMEI---ILKEFGVDLLIKSDTIEDYSVRIEGRKRISGCNLKIPG  243 (449)
Q Consensus       167 ~~~~~~S~q~~s~lLlA~~~~~g~t~i~~~~~s~~~i~~---~L~~fG~~i~~~~~~~~~~~i~i~g~~~l~~~~~~Ip~  243 (449)
T Consensus       158 i~l~~~S~~~t~~lLlAa~~A~G~T~I~-n~~~ePei~~t~~mL~~~G~~I~~~~~----~~i~I~G~~~l~~~~~~V~g  232 (417)
T PRK09369        158 IVLDFPSVGATENILMAAVLAEGTTVIE-NAAREPEIVDLANFLNKMGAKISGAGT----DTITIEGVERLHGAEHRVIP  232 (417)
T ss_pred             EECCCCCHHHHHHHHHHHHHCCCCCCCC-CCCCCCCHHHHHHHHHHCCCCEEECCC----CEEEEECCCCCCCCEEECCC
T ss_conf             3357687457778997776458960245-567786199999999977984782599----65999587655572334587


Q ss_pred             CHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHCCCCCCCCCCCCEEEEECCCCCEEEEEECCCCCCCCCCCCCC
Q ss_conf             11221000001122556532223332322222221000001343234442278703432025642023332346443543
Q gi|254780458|r  244 DSSIAFFPLAAALLIPGSDIKLLNVLTNPLRVGIIDILREMGADITLSNSRIESGENIADIRVRFSKIKGITISDNRLRS  323 (449)
Q Consensus       244 D~ssAa~~la~a~l~~g~~i~i~n~~~~~~q~~~ldiL~~mG~~i~~~~~~~~~~~~~~~i~~~~~~l~g~~i~~~~~~~  323 (449)
T Consensus       233 D~ssAa~fl~Aaait-gg~v~i~~v~~~~~~~-~l~vL~~MGa~i~~~~~~i~v--------~~~~~l~~i~i~~~~~Pg  302 (417)
T PRK09369        233 DRIEAGTFLVAAAIT-GGDITIRGARPEHLEA-VLAKLREAGAEIEEGEDGIRV--------DMPGRLKAVDIKTAPYPG  302 (417)
T ss_pred             CHHHHHHHHHHHHHC-CCCEEEECCCHHHHHH-HHHHHHHCCCEEEEECCEEEE--------ECCCCCCCEEEECCCCCC
T ss_conf             778999999999983-9918994786467589-999999769989980999999--------627874412686675899


Q ss_pred             CH-HHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCEEEEECCCCCCCCCCCCCCEEECCCCH
Q ss_conf             01-11011123222234741002720012456899999999746978999889599976788766665687266048845
Q gi|254780458|r  324 IV-DEYPILLVISAFAEGETIIKGLAEVMTSKQFSGIIECFN