PSIBLAST alignment of GI: 254780458 and protein with PDB id: 2rl1

gi|170785034|pdb|2RL1|A Chain A, Crystal Structure Of Udp-N-Acetylglucosamine Enolpyruvyl Transferase From Haemophilus Influenzae In Complex With Udp-N-Acetylglucosamine Length = 424
>gi|170785035|pdb|2RL2|A Chain A, Crystal Structure Of Udp-N-Acetylglucosamine Enolpyruvyl Transferase From Haemophilus Influenzae In Complex With Udp-N-Acetylglucosamine And Fosfomycin Length = 424
 Score =  167 bits (421), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 63/433 (14%), Positives = 130/433 (30%), Gaps = 26/433 (6%)

Query: 16  CGLQGTICIPGDRSLSHFSIILGGIAAGETQIRGVLESDDVLNTMRMMHYLGARFTKKD- 74
             L G++ I G ++ +   +    +A    ++  V E  D+  T++++  LG    +   
Sbjct: 10  SRLSGSVNISGAKNAALPILFAAILATEPVKLTNVPELKDIETTLKILRQLGVVVDRDAT 69

Query: 75  REWIVQGVGNGCLLSPEYPLDFKGFDMGYGLMMGVVGVYDFQTFFKGRAEILQPTIESLL 134
              ++         +P   +      + + L   V   +  Q    G   I    ++  +
Sbjct: 70  GAVLLDASNINHFTAPYELVKTMRASI-WALAPLVARFHQGQVSLPGGCSIGARPVDLHI 128

Query: 135 APLYQMGVQVK