HHsearch alignment for GI: 254780459 and conserved domain: TIGR00354

>TIGR00354 polC DNA polymerase II, large subunit DP2; InterPro: IPR004475 This family represents the large subunit, DP2, of a two subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit.; GO: 0003677 DNA binding, 0003887 DNA-directed DNA polymerase activity, 0006260 DNA replication, 0006308 DNA catabolic process.
Probab=91.63  E-value=0.088  Score=31.80  Aligned_cols=25  Identities=28%  Similarity=0.400  Sum_probs=14.6

Q ss_pred             CCCCCCCCCEEEECCCCCCCCCCCCCEECH
Q ss_conf             311788887442148887227789871532
Q gi|254780459|r    9 KRTCPDTGKRFYDLNKQVIVSPYTQNSWPL   38 (129)
Q Consensus         9 KR~C~~Cg~KFYDlnk~PiiCP~CG~e~~~   38 (129)
T Consensus       679 ~~~CP~Cgk~s~-----~~~Cp~CG~~te~  703 (1173)
T TIGR00354       679 IAKCPSCGKESL-----YRVCPVCGEKTEL  703 (1173)
T ss_pred             CCCCCCCCCCCE-----EEECCCCCCEEEE
T ss_conf             121887664000-----0145778854544